(data stored in ACNUC7421 zone)

EMBL: AM946981.CRCB

AM946981.CRCB        Location/Qualifiers
FT   CDS_pept        complement(617910..618293)
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="B21_00583"
FT                   /product="protein involved in resistance to camphor-induced
FT                   chromosome decondensation"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31100"
FT                   /protein_id="CAQ31100.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     gtgttacaac ttcttttagc agtttttatt ggcggtggta cgggaagcgt ggcgagatgg        60
     ctgttaagta tgcgatttaa cccgctgcat caggcgattc cgttggggac gctggcagca       120
     aacctgattg gggcattcat cataggaatg ggattcgcat ggttcagcag gatgacgaac       180
     attgatccag tgtggaaagt attaatcacc accggatttt gtggcggtct aacaaccttc       240
     tcaacatttt cggcagaagt ggtgtttttg ttacaagagg gtcgctttgg ctgggcatta       300
     ctgaacgttt tcgtcaacct tctggggtct tttgccatga cagcactggc tttctggctg       360
     ttttcggcct caaccgcaca ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page