(data stored in ACNUC7421 zone)

EMBL: AM946981.D

AM946981.D           Location/Qualifiers
FT   CDS_pept        774215..774547
FT                   /transl_table=11
FT                   /gene="D"
FT                   /locus_tag="B21_00736"
FT                   /product="enterobacteria phage lambda, head-DNA
FT                   stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00736"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31253"
FT                   /protein_id="CAQ31253.1"
FT                   /translation="MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSR
FT                   KLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAG
FT                   TAISIV"
     atgacgagca aagaaacctt tacccattac cagccgcagg gcaacagtga cccggctcat        60
     accgcaaccg cgcccggcgg attgagtgcg aaagcgcctg caatgacccc gctgatgctg       120
     gacacctcca gccgtaagct ggttgcgtgg gatggcacca ccgacggtgc tgccgttggc       180
     attcttgcgg ttgctgctga ccagaccagc accacgctga cgttctacaa gtccggcacg       240
     ttccgttatg aggatgtgct ctggccggag gctgccagcg acgagacgaa aaaacggacc       300
     gcgtttgccg gaacggcaat cagcatcgtt taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page