(data stored in ACNUC7421 zone)

EMBL: AM946981.DACC

AM946981.DACC        Location/Qualifiers
FT   CDS_pept        864640..865842
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="B21_00823"
FT                   /product="penicillin-binding protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00823"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31340"
FT                   /protein_id="CAQ31340.1"
FT                   /translation="MTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILM
FT                   DYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPA
FT                   LRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLG
FT                   LTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNR
FT                   LLWSSNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWG
FT                   FRFFETVTPIKPDATFVTQRVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQ
FT                   LTAPLKKGQVVGTIDFQLNGKSIEQRPLIVMENVEEGGFFGRVWDFVMMKFHQWFGSWF
FT                   S"
     atgacgcaat actcctctct ccttcgtggt cttgcagcgg gttctgcatt tttattcctt        60
     tttgccccaa cggcattcgc ggccgaacaa accgttgaag cgccgagcgt ggatgcgcgt       120
     gcatggattt taatggatta cgccagcggt aaagtgctgg cagaaggcaa tgcggatgag       180
     aaactggatc ccgcgagcct gactaaaatc atgaccagct atgtggttgg gcaggcgctt       240
     aaggccgata agattaaact caccgatatg gtgacggtcg gtaaagatgc ctgggcgacg       300
     ggaaatccgg cactgcgtgg ttcatcggta atgttcctca aaccgggcga tcaggtttcg       360
     gtggcagact tgaacaaagg tgtgattatc cagtccggta atgacgcctg tattgcgctg       420
     gccgattacg ttgccgggag ccaggagtca tttattggtc tgatgaatgg ttatgccaaa       480
     aaactggggc tgaccaacac taccttccag acggtgcacg gtctggatgc gccggggcag       540
     ttcagtaccg cgcgcgatat ggcattgctg ggtaaagcat tgatccacga tgtgccggaa       600
     gagtacgcca ttcataaaga gaaagagttc accttcaaca aaattcgtca gcctaaccgt       660
     aaccgtctgc tgtggagcag caatctgaat gttgatggca tgaagacagg aaccacggca       720
     ggtgcgggat ataatctggt tgcttcggct acccagggtg atatgcgttt aatctccgta       780
     gtgctggggg cgaaaactga ccgtatccgt tttaatgagt ctgagaaatt attgacctgg       840
     ggtttccgct tctttgaaac cgtgacgcca attaaacctg atgccacctt tgtgactcag       900
     cgcgtctggt ttggtgataa gagcgaagtg aatctcgggg caggtgaagc gggctcagtg       960
     accataccgc gtgggcagct gaaaaacctg aaagcgagtt atacgttaac ggaaccgcag      1020
     cttaccgcac cgctgaaaaa aggtcaggtt gtcgggacca ttgatttcca gcttaacggt      1080
     aaatccattg agcagcgtcc gctgatcgtg atggaaaatg tggaagaggg cggattcttt      1140
     ggtcgggtgt gggatttcgt gatgatgaaa ttccatcagt ggttcggcag ctggttctct      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page