(data stored in ACNUC7421 zone)

EMBL: AM946981.DPS

AM946981.DPS         Location/Qualifiers
FT   CDS_pept        complement(832394..832897)
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="B21_00796"
FT                   /product="stationary phase nucleoid protein that sequesters
FT                   iron and protects DNA from damage, subunit of Dps complex;
FT                   stationary phase nucleoid component that sequesters iron
FT                   and protects DNA from damage"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00796"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31313"
FT                   /protein_id="CAQ31313.1"
FT                   /translation="MSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSL
FT                   ITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAERAVQLGGVALGTTQVINSKTPL
FT                   KSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIE
FT                   SNIE"
     atgagtaccg ctaaattagt taaatcaaaa gcgaccaatc tgctttatac ccgcaacgat        60
     gtctccgaca gcgagaaaaa agcaacagta gagttgctga atcgccaggt tatccagttt       120
     attgatcttt ctttgattac caaacaagcg cactggaaca tgcgcggcgc taacttcatt       180
     gccgtacatg aaatgctgga tggcttccgc accgcactga tcgatcatct ggataccatg       240
     gcagaacgtg cagtgcagct gggcggtgta gctctgggga ccactcaagt tatcaacagc       300
     aaaaccccgc tgaaaagtta cccgctggac atccacaacg ttcaggatca cctgaaagaa       360
     ctggctgacc gttacgcaat cgtcgctaat gacgtacgca aagcgattgg cgaagcgaaa       420
     gatgacgaca ccgcagatat cctgaccgcc gcgtctcgcg acctggataa attcctgtgg       480
     tttatcgagt ctaacatcga ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page