(data stored in ACNUC7421 zone)

EMBL: AM946981.FIU

AM946981.FIU         Location/Qualifiers
FT   CDS_pept        complement(823235..825517)
FT                   /transl_table=11
FT                   /gene="fiu"
FT                   /locus_tag="B21_00789"
FT                   /product="putative outer membrane receptor for iron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00789"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31306"
FT                   /protein_id="CAQ31306.1"
FT                   /translation="MENNRNFPARQFHSLTFFAGLCIGITPVAQALAAEGQANADDTLV
FT                   VEASTPSLYAPQQSADPKFSRPVADTTRTMTVISEQVIKDQGATNLTDALKNVPGVGAF
FT                   FAGENGNSTTGDAIYMRGADTSNSIYIDGIRDIGSVSRDTFNTEQVEVIKGPSGTDYGR
FT                   SAPTGSINMISKQPRNDSGIDASASIGSAWFRRGTLDVNQVIGDTTAVRLNVMGEKTHD
FT                   AGRDKVKNERYGVAPSVAFGLGTANRLYLNYLHVTQHNTPDGGIPTIGLPGYSAPSAGT
FT                   AALNHSGKVDTHNFYGTDSDYDDSTTDTATMRFEHDINDNTTIRNTTRWSRVKQDYLMT
FT                   AIMGGASNITQPTSDVNSWTWSRTANTKDVSNKILTNQTNLTSTFYTGSIGHDVSTGVE
FT                   FTRETQTNYGVNPVTLPAVNIYHPDSSIHPGGLTRNGANANGQTDTFAIYAFDTLQITR
FT                   DFELNGGIRLDNYHTEYDSATACGGSGRGAITCPVGVAKGSPVTTVDTARSGNLVNWKA
FT                   GALYHLTENGNVYINYAVSQQPPGGNNFALAQSGSGNSANRTDFKPQKANTSEIGTKWQ
FT                   VLDKRLLLTAALFRTDIENEVEQNDDGTYSQYGKKRVEGYEISVAGNITPAWQVIGGYT
FT                   QQKATIKNGKDVAQDGSSSLPYTPEHAFTLWSQYQATDDISVGAGARYIGSMHKGSDGA
FT                   VGTPAFTEGYWVADAKLGYRVNRNLDFQLNVYNLFDTDYVASINKSGYRYHPGEPRTFL
FT                   LTANMHF"
     atggaaaaca atcgcaattt ccctgccaga caatttcatt cgctcacgtt ctttgccggt        60
     ctttgtattg gtattacgcc tgtggcacag gcactcgccg ccgaagggca agctaacgcg       120
     gatgacacgc tggttgtcga agcatcaacg ccttcgcttt atgcgccaca acaatctgcc       180
     gatccgaaat tctcgcgtcc ggtagcggat actacccgca cgatgacggt gatttctgaa       240
     caagtgatta aagatcaggg cgcaaccaac cttaccgacg cgctcaaaaa cgtccccggc       300
     gtgggtgcgt tttttgcggg tgagaacggt aactccacca ctggcgacgc catttatatg       360
     cgtggtgccg atacctctaa cagcatttat attgatggca ttcgcgatat cggcagcgtc       420
     tcgcgcgaca ccttcaatac cgagcaggtc gaagtgatta aagggccgtc cggcaccgac       480
     tacgggcgca gcgcaccgac gggctcgatc aatatgatca gcaaacagcc gcgcaatgat       540
     tccggcattg acgcctccgc cagtattggc agcgcctggt tccgccgcgg cacgctggac       600
     gtcaatcagg tcattggtga tactaccgcg gtgcgcctga atgtgatggg cgaaaaaacg       660
     cacgatgccg gacgcgacaa agtcaaaaat gagcgttacg gcgtcgcccc ttctgtcgct       720
     tttggccttg gtacagcgaa tcgtttgtat cttaattatc tgcatgtcac tcagcacaac       780
     acgccagacg gcggcattcc gaccatcggt ttgccgggct attctgcccc atctgcggga       840
     acggcggccc tgaatcattc cggaaaagtt gatactcata acttttacgg cacggattcc       900
     gattacgacg attcgaccac cgacaccgcc accatgcgtt ttgagcacga catcaacgat       960
     aacaccacca ttcgcaatac tacccgttgg tcgcgcgtaa agcaggatta cctgatgacg      1020
     gcgattatgg gcggggcgtc gaatattact caacccacca gcgatgtgaa tagctggacc      1080
     tggtcacgca cggcgaatac caaagatgtg agtaataaaa ttctcaccaa ccagaccaac      1140
     ctgacctcga cgttctatac cggttctatc ggtcatgatg tcagtaccgg cgtggaattt      1200
     acccgtgaaa cgcagactaa ctacggcgtt aatccggtga cgttacctgc ggtaaatatt      1260
     tatcatcctg acagcagcat tcatcccggc ggcctgacgc gcaacggcgc aaacgccaat      1320
     ggtcagacgg ataccttcgc aatttacgcc tttgatacgc tgcaaatcac ccgtgatttt      1380
     gagctgaacg gcgggatccg tctggataat tatcatactg aatatgacag tgccaccgcc      1440
     tgcggcggca gcggacgcgg tgccatcacc tgcccagttg gtgtggcaaa aggttctccg      1500
     gtcactaccg tcgacaccgc caggtcgggc aatctggtga actggaaagc cggggcgctg      1560
     tatcacctga cggaaaacgg caatgtctat attaactatg ccgtttccca gcagcctcca      1620
     ggcggcaaca acttcgccct tgcgcagtct ggcagcggta acagtgccaa ccgcaccgat      1680
     tttaaaccgc aaaaagccaa caccagcgag attggcacca aatggcaggt tctggataaa      1740
     cgcctgttgc tcaccgccgc gctgttccgt actgatatcg aaaatgaagt tgagcaaaat      1800
     gatgacggga cttactcgca atacggtaag aaacgcgtcg aaggctatga gatatccgtg      1860
     gccgggaata tcactcccgc gtggcaggtg attggcggct atacccagca aaaagcaacc      1920
     atcaaaaacg gcaaagatgt tgcccaggat ggttcctcat cgctgccgta taccccggag      1980
     cacgccttca ccttatggag ccaatatcag gcaaccgacg atatctctgt tggcgcgggc      2040
     gcacgctata tcggcagtat gcataaaggt tcagacggcg cggtgggaac gccagcgttt      2100
     accgaaggtt actgggtcgc cgatgccaaa ctggggtatc gagttaatcg caatctcgac      2160
     ttccagctaa acgtttacaa cctgtttgat accgattacg tcgcctcaat caacaagagc      2220
     ggctaccgtt atcacccggg cgagccaaga accttcttgc tcacagccaa tatgcatttc      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page