(data stored in ACNUC7421 zone)

EMBL: AM946981.GLNH

AM946981.GLNH        Location/Qualifiers
FT   CDS_pept        complement(831244..831990)
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="B21_00795"
FT                   /product="glnH, subunit of glutamine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00795"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31312"
FT                   /protein_id="CAQ31312.1"
FT                   /translation="MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDK
FT                   YVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFS
FT                   DGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDN
FT                   AYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKV
FT                   NGALKTLRENGTYNEIYKKWFGTEPK"
     atgaagtctg tattaaaagt ttcactggct gcactgaccc tggcttttgc ggtttcttct        60
     catgccgcgg ataaaaaatt agttgtcgcg acggataccg ccttcgttcc gtttgaattt       120
     aaacagggcg ataaatatgt gggctttgac gttgatctgt gggctgccat cgctaaagag       180
     ctgaagctgg attacgaact gaagccgatg gatttcagtg ggatcattcc ggcactgcaa       240
     accaaaaacg tcgatctggc gctggcgggc attaccatca ccgacgagcg taaaaaagcg       300
     atcgatttct ctgacggcta ctacaaaagc ggcctgttag tgatggtgaa agctaacaat       360
     aacgatgtga aaagcgtgaa agatctcgac gggaaagtgg ttgctgtgaa gagcggtact       420
     ggctccgttg attacgcgaa agcaaacatc aaaactaaag atctgcgtca gttcccgaac       480
     atcgataacg cctatatgga actgggcacc aaccgcgcag acgccgttct gcacgatacg       540
     ccaaacattc tgtacttcat caaaaccgcc ggtaacggtc agttcaaagc ggtaggtgac       600
     tctctggaag cgcagcaata cggtattgcg ttcccgaaag gtagcgacga gctgcgtgac       660
     aaagtcaacg gcgcgttgaa aaccctgcgc gagaacggaa cttacaacga aatctacaaa       720
     aaatggttcg gtactgaacc gaaataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page