(data stored in ACNUC7421 zone)

EMBL: AM946981.GLNP

AM946981.GLNP        Location/Qualifiers
FT   CDS_pept        complement(830446..831105)
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="B21_00794"
FT                   /product="glnP, subunit of glutamine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00794"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31311"
FT                   /protein_id="CAQ31311.1"
FT                   /translation="MQFDWSAIWPAIPLLIEGAKMTLWISVLGLAGGLVIGLLAGFART
FT                   FGGWIANHVALVFIEVIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAY
FT                   IAEITRGAVLSIHKGFREAGLALGLSRWETIRYVILPLALRRMLPPLGNQWIISIKDTS
FT                   LFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL"
     atgcagtttg actggagtgc catctggcct gccattccgc ttctgattga aggtgccaaa        60
     atgaccctgt ggatttcggt cctcggtctg gcaggcggtc tggtaatcgg attgctggca       120
     ggttttgcac gcaccttcgg aggttggata gccaaccacg tcgcgctggt ctttattgaa       180
     gtgatccgcg gcacacctat cgtcgtccag gtgatgttta tttatttcgc cctgccgatg       240
     gcgtttaacg acttacgcat cgacccattt actgcggcgg tggtcaccat catgatcaac       300
     tccggcgcgt atattgcgga aatcacgcgt ggtgcggtgc tgtctatcca caaaggtttt       360
     cgtgaagcag gactggcgct cggtctttca cgttgggaaa ccattcgcta cgtcatttta       420
     ccgctggcac tgcgtcgtat gctgccgccg ctgggtaacc agtggatcat cagcattaaa       480
     gacacctcgc tgtttattgt gatcggcgtg gcggaactga cccgtcaggg gcaagaaatt       540
     attgccggta acttccgcgc ccttgagatc tggagcgccg tggcggtgtt ctatctgatt       600
     attaccctgg tgctgagctt tattctgcgt cgtctggaaa gaaggatgaa aatcctgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page