(data stored in ACNUC7421 zone)

EMBL: AM946981.HCP

AM946981.HCP         Location/Qualifiers
FT   CDS_pept        complement(916860..918512)
FT                   /transl_table=11
FT                   /gene="hcp"
FT                   /locus_tag="B21_00884"
FT                   /product="hybrid-cluster protein"
FT                   /EC_number="1.7.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00884"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31401"
FT                   /protein_id="CAQ31401.1"
FT                   /translation="MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIAALQGL
FT                   SAWAVKAREYGIINHDVDSFAPRAFFSTLTNVNFDSPRIVGYAREAIALREALKAQCLA
FT                   VDANARVDNPMADLQLVSDDLGELQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAA
FT                   AYMEHAHVLGQYDNDIYAQYHKIMAWLGTWPADMNALLECSMEIGQMNFKVMSILDAGE
FT                   TGKYGHPTPTQVNVKATAGKCILISGHDLKDLYNLLEQTEGTGVNVYTHGEMLPAHGYP
FT                   ELRKFKHLVGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPG
FT                   VRHLDGDDFSAVITQAQQMAGFPYSEIPHLITVGFGRQTLLGAADTLIDLVSREKLRHI
FT                   FLLGGCDGARGERHYFTDFATSVPDDCLILTLACGKYRFNKLEFGDIEGLPRLVDAGQC
FT                   NDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVKNIVTGPTAP
FT                   GFLTPDLLAVLNEKFGLRSITTVEEDMKQLLSA"
     atgttttgtg tgcaatgtga acaaactatc cgtactccgg caggaaacgg ctgctcatac        60
     gcgcagggga tgtgtggtaa aacggcggaa acttctgacc ttcaggattt actcatcgcg       120
     gcgctgcaag ggctttctgc ctgggcggta aaagcgcgtg aatacggcat catcaaccac       180
     gatgttgaca gcttcgcgcc acgtgccttt ttctcaaccc tgaccaacgt taacttcgat       240
     tctccgcgta ttgtcggcta cgctcgtgaa gcgattgcct tgcgcgaggc gctgaaagca       300
     caatgcctgg ctgtagatgc caacgcgcgc gtcgataacc cgatggctga cctgcaactg       360
     gtgagcgatg atctcggcga gctgcaacgt caggcagcag aatttacccc taacaaagat       420
     aaagcggcga ttggcgaaaa cattctcggc ctgcgtctgc tgtgcctgta tggcctgaaa       480
     ggtgcggcgg cctatatgga acacgcgcat gttctcggtc aatacgacaa cgatatttat       540
     gcccagtacc ataaaatcat ggcgtggctg gggacctggc ctgccgatat gaacgcgctt       600
     cttgagtgtt caatggaaat cggccagatg aacttcaaag tgatgagcat tctggatgca       660
     ggcgaaaccg gtaaatacgg tcacccgacg ccaacccagg tcaacgtcaa agcgacggcg       720
     ggtaaatgca tcctgatttc cggtcacgat ctcaaagatc tctacaacct gctggaacag       780
     accgaaggca cgggcgttaa tgtttacacc cacggcgaaa tgctgcctgc gcatggctac       840
     ccggagctgc gtaaattcaa gcatctggtc ggtaactacg gcagcggctg gcagaatcag       900
     caagtggagt tcgctcgttt ccctggcccc atcgtgatga cctcgaactg catcatcgac       960
     ccaaccgtag gcgcttatga cgatcgtatc tggacccgca gcattgttgg ctggcctggc      1020
     gtgcgtcatc tggacggtga tgatttctct gcggttatca cccaggcgca acagatggca      1080
     ggcttcccgt acagcgaaat tccgcacctt atcaccgtgg gttttggtcg ccagacgctg      1140
     cttggcgctg ctgatacgct gattgatctg gtgagccgtg aaaaactgcg tcatatcttc      1200
     ctgcttggtg gctgtgacgg cgcacgcggc gagcgccact acttcaccga tttcgccacc      1260
     agcgtgccgg atgactgcct gatcctgacc ctcgcctgtg gtaaatatcg ctttaacaaa      1320
     cttgagtttg gcgatatcga aggtctgccg cgtctggtag atgcaggtca atgtaacgat      1380
     gcttactcag cgattattct ggctgtcact ctggcagaga aactgggctg tggtgtgaac      1440
     gatctgccgc tgtcgctggt gctctcctgg tttgaacaga aagcgatcgt cattctgctg      1500
     acgctgcttt ctctgggcgt gaaaaatatc gtcaccggcc cgactgcacc tggtttcctg      1560
     acaccagacc tgctggcggt gctgaacgag aaattcggcc tgcgttctat caccactgtt      1620
     gaagaagaca tgaagcaact gttgagcgcg taa                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page