(data stored in ACNUC7421 zone)

EMBL: AM946981.INSK-2

AM946981.INSK-2      Location/Qualifiers
FT   CDS_pept        join(642982..642996,642996..643877)
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="insK-2"
FT                   /locus_tag="B21_00609"
FT                   /product="IS150 conserved protein InsB"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00609"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31126"
FT                   /protein_id="CAQ31126.2"
FT                   /translation="MYLKKAESLSSSHEKVKVLNELRQFYPLDELLRAAEIPRSTFYYH
FT                   LKALSKPDKYADVKKRISEIYHENRGRYGYRRVTLSLHREGKQINHKAVQRLMGTLSLK
FT                   AAIKVKRYRSYRGEVGQTAPNVLQRDFKATRPNEKWVTDVTEFAVNGRKLYLSPVIDLF
FT                   NNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGI
FT                   KQSMSRKGNCLDNAVVECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKL
FT                   KGLTPIEYRNQTYMPRV"
     atgtatctaa aaaaggctga aagccttagc tcatcccacg aaaaagtgaa agtactcaac        60
     gagctaaggc agttttatcc tcttgatgag cttctcaggg ctgcggagat accgcgcagt       120
     acgttttatt atcatctaaa ggctctcagc aagcctgaca agtatgcgga cgttaaaaag       180
     cgtattagtg agatttatca cgagaataga ggccgatacg gataccgtag ggtaacgctg       240
     tctcttcatc gagaagggaa acagattaac cataaagctg ttcagcgcct gatgggaacc       300
     ctctcactta aagcagcgat taaggtcaag cgataccgct cttacagagg agaggtaggg       360
     caaaccgccc ctaatgttct ccaaagagat ttcaaggcta cgcggccaaa cgagaagtgg       420
     gttaccgatg ttactgaatt tgcagtcaat gggcgcaagc tgtatttgtc tccagtaata       480
     gatctcttca acaacgaagt tatttcttac agcctttcgg aaagaccagt gatgaacatg       540
     gttgagaata tgctcgatca ggcattcaaa aagcttaatc ctcacgagca tcctgttctg       600
     cactctgacc agggatggca gtatcgtatg agaagatatc aaaatatcct taaagaacat       660
     ggtattaaac aaagcatgtc cagaaaaggc aattgtctgg ataatgctgt ggtggagtgt       720
     ttctttggaa ccttaaagtc ggagtgtttt tatcttgatg agttcagtaa tataagcgaa       780
     ctgaaggatg ctgttacgga atatattgaa tactacaaca gcagaagaat tagcctgaaa       840
     ttaaaaggtc tgactccaat tgaatatcgg aatcagacct atatgcctcg tgtttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page