(data stored in SCRATCH zone)

EMBL: AM946981.IRAP

AM946981.IRAP        Location/Qualifiers
FT   CDS_pept        366005..366265
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="B21_00333"
FT                   /product="anti-adaptor protein for sigma[S] stabilization"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30850"
FT                   /protein_id="CAQ30850.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     atgaaaaatc tcattgctga gttgttattt aagcttgccc aaaaagaaga agagtcgaaa        60
     gaactgtgtg cgcaggtaga agctttggag attatcgtca ctgcaatgct tcgcaatatg       120
     gcgcaaaatg accaacagcg gttgattgat caggtagagg gggcgctgta cgaggtaaag       180
     cccgatgcca gcattcctga cgacgatacg gagctgctgc gcgattacgt aaagaagtta       240
     ttgaagcatc ctcgtcagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page