(data stored in ACNUC7421 zone)

EMBL: AM946981.KIL

AM946981.KIL         Location/Qualifiers
FT   CDS_pept        complement(758302..758445)
FT                   /transl_table=11
FT                   /gene="kil"
FT                   /locus_tag="B21_00715"
FT                   /product="enterobacteria phage lambda, host-killing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00715"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31232"
FT                   /protein_id="CAQ31232.1"
FT                   /translation="MDQTLMAIQTKFTIATFIGDEKMFREAVDAYKKWILILKLRSSKS
FT                   IH"
     atggatcaaa cacttatggc tatccagact aaattcacta tcgccacttt tattggcgat        60
     gaaaagatgt ttcgtgaagc cgtcgacgct tataaaaaat ggatattaat actgaaactg       120
     agatcaagca aaagcattca ctaa                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page