(data stored in ACNUC7421 zone)

EMBL: AM946981.MCBA

AM946981.MCBA        Location/Qualifiers
FT   CDS_pept        complement(825782..826042)
FT                   /transl_table=11
FT                   /gene="mcbA"
FT                   /locus_tag="B21_00790"
FT                   /product="protein involved in colanic acid production"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31307"
FT                   /protein_id="CAQ31307.1"
FT                   /translation="MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGA
FT                   SNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK"
     atgaaaaagt gcctcacact actgattgcc accgtcctga gcggaatctc tctcacggct        60
     tatgccgcgc aaccgatgag taacctggac agcggtcagc tacggcccgc cggtaccgtt       120
     tcggcaactg gcgcatcaaa cctaagcgat ctggaggata aactggcaga aaaagcgcgc       180
     gaacaaggcg cgaaaggtta tgtcattaat tccgcaggcg gaaatgacca gatgttcggt       240
     actgcaacca tctacaaata a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page