(data stored in SCRATCH zone)

EMBL: AM946981.NFSA

AM946981.NFSA        Location/Qualifiers
FT   CDS_pept        895882..896604
FT                   /transl_table=11
FT                   /gene="nfsA"
FT                   /locus_tag="B21_00862"
FT                   /product="NADPH nitroreductase monomer, subunit of NADPH
FT                   nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00862"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31379"
FT                   /protein_id="CAQ31379.1"
FT                   /translation="MTPTIELICGHRSIRHFTDEPISEAQREAIINSARATSSSSFLQC
FT                   SSIIRITDKALREELVTLTGGQKHVAQAAEFWVFCADFNRHLQICPDAQLGLAEQLLLG
FT                   VVDTAMMAQNALIAAESLGLGGVYIGGLRNNIEAVTKLLKLPQHVLPLFGLCLGWPADN
FT                   PDLKPRLPASILVHENSYQPLDKGALAQYDEQLAEYYLTRGSNNRRDTWSDHIRRTIIK
FT                   ESRPFILDYLHKQGWATR"
     atgacgccaa ccattgaact tatttgtggc catcgctcca ttcgccattt cactgatgaa        60
     cccatttccg aagcgcagcg tgaggcgatt attaacagcg cccgtgcgac gtccagttcc       120
     agttttttgc agtgcagtag cattattcgc attaccgaca aagcgttacg tgaagaactg       180
     gtgacgctga ccggcgggca aaaacacgta gcgcaagcgg cggagttctg ggtgttctgt       240
     gccgacttta accgccattt acagatctgt ccggatgctc agctcggcct ggcggaacaa       300
     ctgttgctcg gtgtcgttga tacggcaatg atggcgcaga atgcattaat cgcagcggaa       360
     tcgctgggat tgggcggggt atatatcggc ggcctgcgca ataatattga agcggtgacg       420
     aaactgctta aattaccgca gcatgttctg ccgctgtttg ggctgtgcct tggctggcct       480
     gcggataatc cggatcttaa gccgcgttta ccggcctcca ttttggtgca tgaaaacagc       540
     tatcaaccgc tggataaagg cgcactggcg cagtatgacg agcaactggc ggaatattac       600
     ctcacccgtg gcagcaataa tcgccgggat acctggagcg atcatatccg ccgaacaatc       660
     attaaagaaa gccgcccatt tattctggat tatttgcaca aacagggttg ggcgacgcgc       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page