(data stored in ACNUC7421 zone)

EMBL: AM946981.NINE

AM946981.NINE        Location/Qualifiers
FT   CDS_pept        541510..541680
FT                   /transl_table=11
FT                   /gene="ninE"
FT                   /locus_tag="B21_00503"
FT                   /product="DLP12 prophage, conserved protein similar to
FT                   phage 82 and lambda proteins"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31020"
FT                   /protein_id="CAQ31020.1"
FT                   /translation="MATPLIRVMNGHIYKVPNRRKRKPELKPSEIPTLLGYTASLVDKK
FT                   WLRLAARRNHG"
     atggctacac cgcttattcg tgtcatgaac ggacacatct acaaagtacc aaatcgtcgt        60
     aagcgtaagc ctgagctgaa accatccgaa ataccaacac tgctcggata taccgccagc       120
     ctggttgata aaaaatggtt gcgactggca gcaaggagga atcatggctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page