(data stored in ACNUC7421 zone)

EMBL: AM946981.ORF-64

AM946981.ORF-64      Location/Qualifiers
FT   CDS_pept        764588..764782
FT                   /transl_table=11
FT                   /gene="orf-64"
FT                   /locus_tag="B21_00726"
FT                   /product="enterobacteria phage lambda, hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00726"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31243"
FT                   /protein_id="CAQ31243.1"
FT                   /translation="MKRGGAYYRFRLVGHFDVSSGTPTIAGREVCKMQSRNSSQVIVRA
FT                   CITVSGFFISAQQVRALSR"
     atgaaaagag gcggcgctta ctaccgattc cgcctagttg gtcacttcga cgtatcgtct        60
     ggaactccaa ccatcgcagg cagagaggtc tgcaaaatgc aatcccgaaa cagttcgcag       120
     gtaatagtta gagcctgcat aacggtttcg ggatttttta tatctgcaca acaggtaaga       180
     gcattgagtc gataa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page