(data stored in ACNUC7421 zone)

EMBL: AM946981.PAL

AM946981.PAL         Location/Qualifiers
FT   CDS_pept        737722..738243
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="B21_00690"
FT                   /product="pal, subunit of The Tol-Pal Cell Envelope
FT                   Complex, Colicin S4 Transport System and The Colicin A
FT                   Import System"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31207"
FT                   /protein_id="CAQ31207.1"
FT                   /translation="MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDA
FT                   NGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVT
FT                   VEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAY
FT                   SKNRRAVLVY"
     atgcaactga acaaagtgct gaaagggctg atgattgctc tgcctgttat ggcaattgcg        60
     gcatgttctt ccaacaagaa cgccagcaat gacggcagcg aaggcatgct gggtgccggc       120
     actggtatgg atgcgaacgg cggcaacggc aacatgtctt ccgaagagca ggctcgtctg       180
     caaatgcaac agctgcagca gaacaacatc gtttacttcg atctggacaa gtacgatatc       240
     cgttctgact tcgctcaaat gctggatgca catgcaaact tcctgcgtag caacccgtct       300
     tacaaagtca ccgtagaagg tcacgcggac gaacgtggta ctccggaata caacatctcc       360
     ctgggtgaac gtcgtgcgaa cgccgttaag atgtacctgc agggtaaagg cgtttctgca       420
     gaccagatct ccatcgtttc ttacggtaaa gaaaaacctg cagtactggg tcatgacgaa       480
     gcggcatact ccaaaaaccg tcgtgcggta ctggtttact aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page