(data stored in ACNUC7421 zone)

EMBL: AM946981.POTF

AM946981.POTF        Location/Qualifiers
FT   CDS_pept        898482..899594
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="B21_00865"
FT                   /product="potF, subunit of putrescine ABC transporter"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00865"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31382"
FT                   /protein_id="CAQ31382.1"
FT                   /translation="MTALNKKWLSGLVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDT
FT                   VANFEKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKS
FT                   KLPEWKNLDPELLKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLI
FT                   LKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIR
FT                   YFHSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFA
FT                   MPADAKNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLVSAEVRDNPGIYPPAD
FT                   VRAKLFTLKVQDPKIDRVRTRAWTKVKSGK"
     atgaccgcct taaataaaaa atggctatcg ggtctggttg cgggtgctct gatggccgtc        60
     tctgtcggca cgctcgcggc tgaacaaaaa acactccaca tttataactg gtctgattat       120
     atcgccccgg acacggtggc caattttgaa aaagaaaccg gtattaaagt cgtctacgat       180
     gttttcgact ctaacgaagt actggaaggc aaattaatgg ccgggagtac cggctttgat       240
     ctggtggttc catctgccag ctttctggag cgccagttga ctgcgggagt tttccagccg       300
     ctggacaaaa gcaaattgcc ggagtggaag aatctcgacc cggaactgct gaagctggtc       360
     gccaaacacg atcccgacaa taaatttgct atgccctata tgtgggcgac gaccgggatt       420
     ggctataacg ttgataaagt taaagcggtg ctgggcgaaa acgcgcccgt cgatagctgg       480
     gacttgatcc tcaaacctga aaatctggaa aaactgaaaa gctgcggtgt ctctttcctg       540
     gatgcgccag aagaagtttt tgctaccgtg ttgaattatc tcggcaaaga tcccaacagc       600
     actaaagcgg atgattacac cggaccggca acagatctgc tgttaaagct gcgcccgaac       660
     attcgttatt tccattcatc tcaatacatt aacgacctgg cgaatggtga catctgcgtg       720
     gcgattggtt gggcaggtga tgtctggcag gcgtcaaacc gcgcgaagga agcgaagaat       780
     ggcgtgaatg tctcgttctc gattccaaaa gaaggggcga tggcgttctt tgatgtattc       840
     gccatgcctg ccgatgccaa aaataaagac gaagcctatc agttcctgaa ttacctgctg       900
     cgtccggatg tggtggcaca tatctctgac catgtgttct atgctaacgc caataaagca       960
     gccacgccgc tggtgagtgc ggaagttcgt gataacccgg gtatttatcc gcctgcggat      1020
     gtccgtgcga agctgttcac tctgaaagtg caggacccga aaatcgaccg tgtgcgcacc      1080
     cgcgcgtgga ccaaagtgaa gagcggaaaa taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page