(data stored in ACNUC7421 zone)

EMBL: AM946981.POTG

AM946981.POTG        Location/Qualifiers
FT   CDS_pept        899689..900822
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="B21_00866"
FT                   /product="potG, subunit of putrescine ABC transporter"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00866"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31383"
FT                   /protein_id="CAQ31383.1"
FT                   /translation="MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKG
FT                   EIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFP
FT                   HMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARS
FT                   LAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAI
FT                   MNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKV
FT                   DADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQ
FT                   MISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVVLTV"
     gtgaatgacg ctatccctcg cccgcaggcg aaaacccgta aggcgctgac gccgctatta        60
     gaaatccgca acctcaccaa atcctacgat ggtcaacatg cggtggatga tgtcagcctg       120
     actatctaca aaggtgaaat cttcgcgctg ctgggcgcat ccggctgtgg caagtccacg       180
     ctgctgcgta tgctggcagg tttcgaacaa ccttctgccg gacagataat gcttgatggc       240
     gtcgatttgt cacaggttcc gccttacctg cgccccatca atatgatgtt tcagtcttac       300
     gcgctgtttc cgcatatgac cgtggaacag aacatcgctt ttggcctgaa acaggacaaa       360
     ctaccgaaag cggaaattgc cagtcgggtc aatgagatgc tcggcctggt gcacatgcag       420
     gagttcgcca aacgcaaacc gcatcagctt tccggtggtc agcgacagcg tgtggccctg       480
     gcccgaagcc ttgccaaacg cccgaaacta ttactgctcg atgagccgat gggcgcgctg       540
     gataaaaagc tgcgtgaccg gatgcagctt gaagtggtgg atattctgga gcgcgtcggt       600
     gtgacttgtg tgatggtcac ccacgatcag gaagaggcga tgaccatggc ggggcgtatc       660
     gccattatga atcgcgggaa atttgtccag attggcgagc cggaagagat ctacgagcat       720
     ccaactaccc gctacagcgc tgaatttatc ggttcggtta atgtctttga aggtgtactc       780
     aaagagcgtc aggaagatgg cttggtgctt gattcgccgg ggctggtgca tccactgaaa       840
     gtcgatgcgg atgcttcagt ggtcgataac gtgccggtac acgtagcgct gcgcccggaa       900
     aaaatcatgc tttgcgaaga gccgcccgcc aatggttgta acttcgcggt gggggaggtg       960
     atacacattg cctatctcgg cgatctttcg gtgtatcacg ttcgactgaa aagtgggcag      1020
     atgatcagcg cccagctaca aaatgcccat cgtcatcgta aagggttacc gacctggggc      1080
     gacgaagtgc gtttgtgctg ggaagtggac agctgtgtgg tgctgacggt ttaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page