(data stored in ACNUC7421 zone)

EMBL: AM946981.REND

AM946981.REND        Location/Qualifiers
FT   CDS_pept        536651..536836
FT                   /transl_table=11
FT                   /gene="renD"
FT                   /locus_tag="B21_00497"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31014"
FT                   /protein_id="CAQ31014.1"
FT                   /translation="MARAGILVVDGKVWRTVYYRFATREEREGKVSTNLIFKECRQSAA
FT                   MKRVLRVYKRTSMGTQ"
     atggcgcggg caggaatcct ggtcgttgat ggtaaggtct ggcgaacggt gtattaccgg        60
     ttcgctacca gagaagaacg ggaaggaaag gtgagcacga atctgatttt taaggagtgt       120
     cgccagagtg ccgcgatgaa acgggtactg agggtatata aaagaacatc aatgggaaca       180
     caatga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page