(data stored in ACNUC7421 zone)

EMBL: AM946981.RIMK

AM946981.RIMK        Location/Qualifiers
FT   CDS_pept        896665..897567
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="B21_00863"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00863"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31380"
FT                   /protein_id="CAQ31380.1"
FT                   /translation="MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAA
FT                   SSIHYKGRKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSM
FT                   QLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESV
FT                   IDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASV
FT                   ASITPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGK
FT                   MIRWIERHATTEYCLKTGG"
     gtgaaaattg ccatattgtc ccgggatgga acgctctatt cgtgtaagcg gctgcgtgaa        60
     gccgctatac agcgcggtca cctggttgaa attcttgatc cgctttcttg ctacatgaac       120
     ataaatcctg cggcgtcttc tattcactac aaaggccgca agttacccca ttttgacgca       180
     gtgatcccgc gtattggcac cgccattacc ttttatggga cggcggcact gcgccagttc       240
     gagatgctgg ggagctatcc gctcaatgag tcggtcgcca ttgcccgggc gcgtgacaaa       300
     ttgcgttcca tgcaactgct ggcgcgtcag ggcatcgacc tgcctgtcac gggcattgcg       360
     cattcgccgg atgataccag cgatttaatc gacatggtcg gtggtgcgcc gctggtggtc       420
     aagttggttg aaggcacgca gggaattggc gtcgtgctgg cggagacgcg tcaggcggcg       480
     gaaagcgtga ttgacgcttt ccgcggtctg aacgcgcata ttctggtgca ggaatatatc       540
     aaagaggcgc aagggtgcga tatccgctgt ctggttgttg gcgatgaagt ggtcgctgcg       600
     attgaacggc gggcgaaaga gggcgatttt cgttccaatt tgcatcgtgg cggcgcggca       660
     agcgtcgcca gtatcacacc acaggagcgt gaaatcgcga taaaagccgc gcgaacgatg       720
     gcgctggacg ttgctggtgt ggatattctg cgtgctaatc gcgggccgtt ggtgatggag       780
     gtgaatgcgt cgccggggct ggaaggaata gaaaaaacca ccggtatcga catcgcgggt       840
     aaaatgatcc gctggatcga acgccacgct acgacagaat attgcctgaa aacgggtggt       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page