(data stored in ACNUC7421 zone)

EMBL: AM946981.SDHD

AM946981.SDHD        Location/Qualifiers
FT   CDS_pept        714124..714471
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="B21_00671"
FT                   /product="succinate dehydrogenase membrane protein, subunit
FT                   of succinate dehydrogenase"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31188"
FT                   /protein_id="CAQ31188.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
     atggtaagca acgcctccgc attaggacgc aatggcgtac atgatttcat cctcgttcgc        60
     gctaccgcta tcgtcctgac gctctacatc atttatatgg tcggtttttt cgctaccagt       120
     ggcgagctga catatgaagt ctggatcggt ttcttcgcct ctgcgttcac caaagtgttc       180
     accctgctgg cgctgttttc tatcttgatc catgcctgga tcggcatgtg gcaggtgttg       240
     accgactacg ttaaaccgct ggctttgcgc ctgatgctgc aactggtgat tgtcgttgca       300
     ctggtggttt acgtgattta tggattcgtt gtggtgtggg gtgtgtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page