(data stored in SCRATCH zone)

EMBL: AM946981.TAUB

AM946981.TAUB        Location/Qualifiers
FT   CDS_pept        352088..352855
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="B21_00320"
FT                   /product="tauB, subunit of taurine ABC transporter"
FT                   /EC_number="3.6.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30837"
FT                   /protein_id="CAQ30837.1"
FT                   /translation="MLQISHLYANYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQNNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     atgctgcaaa tctctcatct ttacgccaat tatggcggca aaccggcact ggaagatatc        60
     aacctgacgc tggaaagcgg tgagctactg gtggtgctgg ggccgtccgg ctgcggtaaa       120
     accaccctgc tgaatctgat tgccggtttt gtgccttatc agcacggcag cattcaactg       180
     gcgggtaagc gtattgaggg gccgggagca gagcgcggcg tggtttttca gaatgaaggg       240
     ctgctaccgt ggcgcaatgt ccagaacaac gtggcgttcg gcctgcaact ggcaggtata       300
     gagaaaatgc agcgactgga aatcgcgcac cagatgctga aaaaagtggg gctggaagga       360
     gcagaaaaac gctacatctg gcagctctcc ggcggtcaac gtcagcgggt gggcattgct       420
     cgcgcgctgg cggcaaatcc ccagctgtta ttactcgacg aaccgtttgg tgcgctggat       480
     gccttcaccc gcgaccagat gcaaaccctg ctgctgaaac tctggcagga gacgggcaag       540
     caggtgctgt tgattaccca cgatatagaa gaagcggtgt ttatggcgac tgaactggtt       600
     ctgctttcac ccggccctgg ccgcgtgctg gagcggctgc cgctcaactt tgctcgccgc       660
     tttgttgcgg gagagtcgag ccgcagcatc aagtccgatc cacaattcat cgccatgcgc       720
     gaatatgttt taagccgcgt atttgagcag cgggaggcgt tctcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page