(data stored in ACNUC7421 zone)

EMBL: AM946981.YAHM

AM946981.YAHM        Location/Qualifiers
FT   CDS_pept        315027..315272
FT                   /transl_table=11
FT                   /gene="yahM"
FT                   /locus_tag="B21_00286"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30803"
FT                   /protein_id="CAQ30803.1"
FT                   /translation="MAVQLFKTLLNQIPLLSSLQSGTLPLFGYSGWGRPMKKAHTGESG
FT                   LKWEAKDSSKLIGNKDHALRGLSSPMAVIRQIRLIT"
     atggcggtcc aacttttcaa aactcttctg aatcagatcc ccttattatc atccctgcaa        60
     agtggaacat tgccattgtt tggctattca ggatggggca gaccaatgaa aaaagcccac       120
     acaggggaga gtgggctgaa atgggaagct aaagactcaa gtaaacttat cggaaataag       180
     gaccacgcat tacgggggct atcatcgccg atggccgtga ttcggcaaat caggttgatt       240
     acgtag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page