(data stored in ACNUC7421 zone)

EMBL: AM946981.YAHO

AM946981.YAHO        Location/Qualifiers
FT   CDS_pept        316107..316382
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="B21_00288"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30805"
FT                   /protein_id="CAQ30805.1"
FT                   /translation="MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
     atgaaaataa tctctaaaat gttagtcggt gcgttagcgt tagccgttac caatgtctat        60
     gccgctgaat tgatgaccaa agcggaattt gaaaaagttg aatcgcagta tgaaaaaata       120
     ggtgatattt caaccagtaa tgaaatgtcg accgcagatg cgaaagagga tttgatcaaa       180
     aaagcggatg aaaaaggggc tgatgtgttg gtactgacct ccggtcaaac tgacaataag       240
     atccacggca cggcaaatat ttataagaag aagtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page