(data stored in SCRATCH zone)

EMBL: AM946981.YBAN

AM946981.YBAN        Location/Qualifiers
FT   CDS_pept        459922..460299
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="B21_00424"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30941"
FT                   /protein_id="CAQ30941.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     atgcaacgaa tcattttaat catcattggc tggctggcgg tagtgctggg tacgctgggc        60
     gtggtattac cggtattacc gacgacgccg tttatcctgc tggcggcctg gtgctttgcc       120
     cgttcttccc cgcgctttca cgcctggttg ctgtaccgct catggtttgg cagctatcta       180
     cgtttctggc agaaacatca tgcgatgccg cgcggcgtca aaccgcgggc gattttgctt       240
     attttgctca cgtttgccat ttctctgtgg ttcgtccaga tgccatgggt gcgcatcatg       300
     ttgctggtaa ttctcgcctg tttgcttttc tatatgtggc gaattccggt gattgatgaa       360
     aagcaagaaa agcactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page