(data stored in ACNUC7421 zone)

EMBL: AM946981.YBAV

AM946981.YBAV        Location/Qualifiers
FT   CDS_pept        432965..433336
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="B21_00398"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30915"
FT                   /protein_id="CAQ30915.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQ
FT                   SKAAVLAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     atgaaacacg gaattaaagc actgctcatt accctgtctc tggcttgtgc cggaatgtct        60
     catagcgcgc tggcggcagc tcctgcggcg aaaccgacaa cggtagaaac caaagcggaa       120
     gctcctgcag cacaaagtaa agcagcagta ctggcgaaag ccagtgacga agaaggcacc       180
     cgggtcagca ttaataatgc cagcgcggaa gagttagccc gcgcgatgaa tggcgttggc       240
     ctgaagaaag cgcaggcgat tgtcagttat cgcgaagagt acggtccgtt taaaacggtg       300
     gaggatctaa agcaggtgcc ggggatgggc aattcgctgg tggaacgtaa tctggcggta       360
     ttaaccctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page