(data stored in SCRATCH zone)

EMBL: AM946981.YBBL

AM946981.YBBL        Location/Qualifiers
FT   CDS_pept        485060..485737
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="B21_00446"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30963"
FT                   /protein_id="CAQ30963.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     atgcaggaaa atagtccttt gcttcagcta caaaacgtag gatatctggc gggtgatacg        60
     aagattctta ataacatcaa tttttcgctg cgtgctggcg aatttaagtt aattaccggt       120
     ccttctggtt gtggcaaaag tacgctgcta aaaatagttg cttcattgat cagcccaacc       180
     agcggaacgt tactgtttga aggggaggat gtcagcacac taaagccaga aatctaccgc       240
     cagcaagttt cttactgcgc ccagacgccg acgctgtttg gcgatacggt atacgataac       300
     ctgatttttc cctggcagat ccgtaaccag cagcctgacc cggccatttt tctcgatttt       360
     ctcgaacgct tcgctttgcc ggacagcatt ttgacgaaga atatcgccga gctatctggt       420
     ggtgaaaaac aacgcatctc attgattcgt aacctgcaat ttatgccgaa ggttttattg       480
     ctggatgaaa taaccagtgc gctggatgaa agtaataaac ataacgtcaa tgagatgatc       540
     catcgttatg tgcgcgagca aaatattgcc gtgctgtggg tgacacacga taaagacgaa       600
     attaatcatg cggataaagt gattacactg caaccgcatg ccggagaaat gcaggaagca       660
     cgctatgaac tcgcataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page