(data stored in ACNUC7421 zone)

EMBL: AM946981.YBCO

AM946981.YBCO        Location/Qualifiers
FT   CDS_pept        541673..541963
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /locus_tag="B21_00504"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31021"
FT                   /protein_id="CAQ31021.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLAGLCGTGIKP
FT                   PDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA"
     atggctgatt tgagaaaagc agcgcgtggt cgggaatgcc aggtaagaat ccctggcgta        60
     tgtaatggca atcctgaaac gtctgtactg gcacatatcc ggctggctgg attgtgcggt       120
     accggtatca aaccgccaga cctgattgcc accattgcat gttctgcctg tcacgacgag       180
     atcgaccgtc gcacgcattt tgttgacgct ggatatgcaa aagaatgcgc gctggaaggt       240
     atggcgagaa cgcaggttat ctggctgaaa gagggggtaa ttaaggcgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page