(data stored in ACNUC7421 zone)

EMBL: AM946981.YBEQ

AM946981.YBEQ        Location/Qualifiers
FT   CDS_pept        complement(636392..636904)
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="B21_00602"
FT                   /product="conserved protein, partial"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00602"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31119"
FT                   /protein_id="CAQ31119.2"
FT                   /translation="MIFTSSCCDNLSIDEIIERAEQGDSEAQYIVGFYYNRDSAIDSPD
FT                   DEKAFYWLKLAAEQGHCEAQYSLGRKYSEDKSRHRDNEQAIFWLKKAALQGHTFASNAL
FT                   GWILDRGEDPNYKEAVAWYQIAAESGMSYAQNNLGWMYRNGNGVAQDYALAFFWYKQAA
FT                   LQGHSYA"
     atgattttta cgtcaagttg ctgcgataat ttatcaatag atgagattat cgaacgtgct        60
     gaacaaggcg atagtgaggc tcaatatatt gttgggtttt attataatcg cgatagcgca       120
     attgactctc cggacgacga aaaggccttt tactggctga agcttgccgc tgagcaaggc       180
     cattgtgaag cacaatattc cttagggcgg aaatactccg aggataaaag ccgtcataga       240
     gataatgagc aagccatctt ttggctgaaa aaagctgccc tacaaggcca tacttttgct       300
     tccaacgccc ttggctggat actggatcgt ggagaagacc ccaactataa agaagcggtt       360
     gcctggtatc agatagccgc ggagagcgga atgtcatatg cgcaaaataa tcttggatgg       420
     atgtacagaa atggcaacgg agtcgcacaa gattatgcgc tggcattttt ctggtacaaa       480
     caagctgcat tacaaggcca tagttacgca taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page