(data stored in SCRATCH zone)

EMBL: AM946981.YBFA

AM946981.YBFA        Location/Qualifiers
FT   CDS_pept        689002..689208
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="B21_00648"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00648"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31165"
FT                   /protein_id="CAQ31165.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
     atggaactct acagagaata tcctgcatgg cttatctttt tacgccgtac ttatgcggtt        60
     gcagcgggcg ttctggcgct gcctttcatg cttttctgga aagaccgcgc ccgcttttac       120
     agctacctgc atcgcgtctg gtcgaaaacc agcgataaac cggtgtggat ggatcaggcc       180
     gaaaaggcaa ctggtgattt ttattga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page