(data stored in SCRATCH zone)

EMBL: AM946981.YBGS

AM946981.YBGS        Location/Qualifiers
FT   CDS_pept        complement(743339..743719)
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="B21_00695"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00695"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31212"
FT                   /protein_id="CAQ31212.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
     atgaaaatga caaaactggc cacattattt ctgactgcca ctctaagcct tgccagcggt        60
     gccgcactgg ctgccgatag cggagcgcaa actaataacg gccaggcaaa cgccgcagct       120
     gatgcgggcc aggtagcccc tgacgcccgt gaaaatgtcg cgccaaataa cgtcgacaat       180
     aacggggtaa ataccggttc tggcggcaca atgctgcatt cggatggttc ttcaatgaac       240
     aatgacggaa tgaccaaaga tgaagagcac aagaacacca tgtgcaaaga tggtcgctgt       300
     ccggatatca ataaaaaggt acaaaccggt gatggcatca ataatgatgt cgataccaaa       360
     accgacggta ccacgcagta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page