(data stored in ACNUC7421 zone)

EMBL: AM946981.YBHF

AM946981.YBHF        Location/Qualifiers
FT   CDS_pept        complement(811231..812967)
FT                   /transl_table=11
FT                   /gene="ybhF"
FT                   /locus_tag="B21_00778"
FT                   /product="ybhF, subunit of YbhF/YbhR/YbhS ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00778"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31295"
FT                   /protein_id="CAQ31295.1"
FT                   /translation="MNDAVITLNGLEKRFPGMDKPAVAPLDCTIHAGYVTGLVGPDGAG
FT                   KTTLMRMLAGLLKPDSGSATVIGFDPIKNDGALHAVLGYMPQKFGLYEDLTVMENLNLY
FT                   ADLRSVTGEARKQTFARLLEFTSLGPFTRRLAGKLSGGMKQKLGLACTLVGEPKVLLLD
FT                   EPGVGVDPISRRELWQMVHELAGEGMLILWSTSYLDEAEQCRDVLLMNEGELLYQGEPK
FT                   ALTQTMAGRSFLMTSPHEGNRKLLQRALKLPQVSDGMIQGKSVRLILKKEATPDDIRHA
FT                   DGMPEININETTPRFEDAFIDLLGGAGTSESPLGAILHTVEGTPGETVIEAKELTKKFG
FT                   DFAATDHVNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDLKESSGK
FT                   ARQHLGYMAQKFSLYGNLTVEQNLRFFSGVYGLRGRAQNEKISRMSEAFGLKSIASHAT
FT                   DELPLGFKQRLALACSLMHEPDILFLDEPTSGVDPLTRREFWLHINSMVEKGVTVMVTT
FT                   HFMDEAEYCDRIGLVYRGKLIASGTPDDLKAQSANDEQPDPTMEQAFIQLIHDWDKEHS
FT                   NE"
     atgaatgatg ccgttatcac gctgaacggc ctggaaaaac gctttccggg catggacaag        60
     cccgccgtcg cgccgctcga ttgtaccatt cacgccggtt atgtgacggg gttggtgggg       120
     ccggacggtg caggtaaaac cacgctgatg cggatgttgg cgggattact gaaacccgac       180
     agcggcagtg ccacggtgat tggctttgat ccgatcaaaa acgacggcgc gctgcacgcc       240
     gtgctcggtt atatgccgca gaaatttggt ctgtatgaag atctcacggt gatggagaac       300
     ctcaatctgt acgcggattt gcgcagcgtc accggcgagg cacgtaagca aacttttgct       360
     cgcctgctgg agtttacgtc tcttgggccg tttaccagac gcctggcggg caagctctcc       420
     ggtgggatga aacaaaaact cggcctggcc tgtaccctgg tgggcgaacc gaaagtgttg       480
     ctgctcgatg aacccggcgt cggcgttgac cctatctcac ggcgcgaact gtggcagatg       540
     gtgcatgagc tggcgggcga agggatgtta atcctctgga gtacctcgta tctcgacgaa       600
     gccgagcagt gccgtgacgt gttactgatg aacgaaggcg agttgctgta tcagggagaa       660
     ccaaaagccc tgacacaaac catggccgga cgcagctttc tgatgaccag tccacacgag       720
     ggcaaccgca aactgttgca acgcgccttg aaactgccgc aggtcagcga cggcatgatt       780
     caggggaaat cggtacgtct gatcctcaaa aaagaggcca caccagacga tattcgccat       840
     gccgacggga tgccggaaat caacatcaac gaaactacgc cgcgttttga agatgcgttt       900
     attgatttgc tgggtggtgc cggaacctca gaatcgccgc tgggtgcaat attgcatacg       960
     gtagaaggca cacccggcga gacggtgatc gaagcgaaag aactgaccaa gaaatttggt      1020
     gattttgccg ccaccgatca cgtcaacttt gccgttaaac gtggggagat ttttggtttg      1080
     ctggggccaa acggcgcggg taaatcgacc acctttaaga tgatgtgcgg tttgctggtg      1140
     ccgacttccg gccaggcgct ggtgctgggg atggatctga aagagagttc cggtaaagcg      1200
     cgccagcatc tcggctatat ggcgcaaaaa ttttcgctct acggcaacct gacggtcgaa      1260
     cagaatttac gctttttctc tggtgtgtat ggcttacgcg gtcgggcgca gaacgaaaaa      1320
     atctcccgta tgagcgaggc atttggcctg aaaagtatcg cctcccacgc gaccgatgaa      1380
     ctgccattag gttttaaaca gcggctggcg ctggcctgtt cgctgatgca tgaaccggac      1440
     attctgtttc tcgacgaacc aacgtccggc gttgatcccc tcacccgccg cgaattttgg      1500
     ctgcatatca acagcatggt agagaaaggc gtcacggtga tggtcaccac tcactttatg      1560
     gatgaagcag aatattgcga ccgcatcggc ctggtgtacc gtgggaaatt aattgccagc      1620
     ggcacgccgg atgatttgaa agcgcagtcg gccaacgacg agcaacccga tcccaccatg      1680
     gagcaagcct ttattcagtt gatccacgac tgggataagg agcatagcaa tgagtaa         1737
//

If you have problems or comments...

PBIL Back to PBIL home page