(data stored in SCRATCH zone)

EMBL: AM946981.YBHG

AM946981.YBHG        Location/Qualifiers
FT   CDS_pept        complement(812960..813958)
FT                   /transl_table=11
FT                   /gene="ybhG"
FT                   /locus_tag="B21_00779"
FT                   /product="predicted membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00779"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31296"
FT                   /protein_id="CAQ31296.1"
FT                   /translation="MMKKPVVIGLAVVVLAAVVAGGYWWYQSRQDNGLTLYGNVDIRTV
FT                   NLSFRVGGRVESLAVDEGDAIKAGQVLGELDHKPYEIALMQAKAGVSVAQAQYDLMLAG
FT                   YRDEEIAQAAAAVKQAQAAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQATLK
FT                   SAQDKLRQYRSGNREQDIAQAKASLEQAQAQLAQAELNLQDSTLIAPSDGTLLTRAVEP
FT                   GTVLNEGGTVFTVSLTRPVWVRAYVDERNLDQAQPGRKVLLYTDGRPDKPYHGQIGFVS
FT                   PTAEFTPKTVETPDLRTDLVYRLRIVVTDADDALRQGMPVTVQFGDEAGHE"
     gtgatgaaaa aacctgtcgt gatcggattg gcggtagtgg tacttgccgc cgtggttgcc        60
     ggaggctact ggtggtatca aagccgccag gataacggcc tgacgctgta tggcaacgtg       120
     gatattcgta cggtaaatct tagtttccgt gttggggggc gcgttgaatc gctggcggtg       180
     gacgaaggtg atgctatcaa agcgggccag gtgctgggcg aactggatca caagccgtat       240
     gagattgccc tgatgcaggc gaaagcgggt gtttcggtgg cacaggcgca gtatgacctg       300
     atgcttgccg ggtatcgcga tgaagaaatc gctcaggccg ccgcagcggt gaaacaggcg       360
     caagccgcct atgactatgc gcagaacttc tataaccgcc agcaagggtt gtggaaaagc       420
     cgcactattt cggcaaatga cctggaaaat gcccgctcct cgcgcgacca ggcgcaggca       480
     acgctgaaat cagcacagga taaattgcgt cagtaccgtt ccggtaaccg tgaacaggac       540
     atcgctcagg cgaaagccag cctcgaacag gcgcaggcgc aactggcgca ggcggagttg       600
     aatttacagg actcaacgtt gatagccccg tctgatggca cgctgttaac gcgcgcggtg       660
     gagccaggca cggtcctcaa tgaaggtggc acggtgttta ccgtttcact aacgcgtccg       720
     gtgtgggtgc gcgcttatgt tgatgaacgt aatcttgacc aggcccagcc ggggcgcaaa       780
     gtgctgcttt ataccgatgg tcgcccggac aagccgtatc acgggcagat tggtttcgtt       840
     tcgccgactg ctgaatttac cccgaaaacc gtcgaaacgc cggatctgcg taccgacctc       900
     gtctatcgcc tgcgtattgt ggtgaccgac gccgatgatg cgttacgcca gggaatgcca       960
     gtgacggtac aattcggtga cgaggcagga catgaatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page