(data stored in ACNUC7421 zone)

EMBL: AM946981.YBHQ

AM946981.YBHQ        Location/Qualifiers
FT   CDS_pept        808616..809026
FT                   /transl_table=11
FT                   /gene="ybhQ"
FT                   /locus_tag="B21_00775"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00775"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31292"
FT                   /protein_id="CAQ31292.1"
FT                   /translation="MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLC
FT                   ALYCVTVVMMLVFQRHPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAI
FT                   AGLAILAGPAVVSLLAKDKKLHHLTSKHRVRR"
     atgaagtggc aacaacgtgt tcgtgtcgca acgggtctaa gttgctggca gattatgttg        60
     catttactgg tagtggcgct gctggtggtg ggctggatga gtaagactct ggttcacgtc       120
     ggcgtgggat tatgcgcact gtattgtgtc acggtagtga tgatgctggt gtttcagcgc       180
     caccccgagc aacgctggcg tgaggtggca gacgtgctgg aagagctgac cacgacctgg       240
     tattttggcg cagcgctgat tgtgctgtgg ctgttgtccc gcgttctgga aaacaacttt       300
     ttgctggcaa ttgcagggct ggcaatcctt gccggcccgg cggtagtgtc tttgctggcg       360
     aaagataaga agttacatca ccttacgtct aaacatcgcg tacgccgctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page