(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIA

AM946981.YBIA        Location/Qualifiers
FT   CDS_pept        complement(816454..816936)
FT                   /transl_table=11
FT                   /gene="ybiA"
FT                   /locus_tag="B21_00782"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00782"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31299"
FT                   /protein_id="CAQ31299.1"
FT                   /translation="MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWP
FT                   TSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAK
FT                   FEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEK"
     atgcccgttc gagcacaaag gatccaacac gtcatgcaag acaccatcat aaatttctac        60
     agcaccagcg atgactacgg tgatttttct aactttgccg cctggcccat caaggttgac       120
     gggaaaacct ggcccacctc agaacactat tttcaggcac aaaaattcct tgatgaaaaa       180
     taccgcgaag agatccgtcg ggtttcttcc cctatggtcg ccgcacgcat ggggcgcgat       240
     cgttctaagc ctctgcgtaa aaactgggag tcggtcaaag aacaggtgat gcgaaaagca       300
     cttcgcgcta aattcgaaca gcatgcagaa ctgcgtgcgc tcttgctggc aaccgcgccc       360
     gcaaaactgg ttgagcatac ggaaaacgat gcttactggg gagacggtgg tcatggtaag       420
     ggcaagaatc gactgggcta ccttttaatg gagttgcgcg aacaattggc tatagagaag       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page