(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIY

AM946981.YBIY        Location/Qualifiers
FT   CDS_pept        complement(846525..847451)
FT                   /transl_table=11
FT                   /gene="ybiY"
FT                   /locus_tag="B21_00808"
FT                   /product="predicted pyruvate formate lyase activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00808"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31325"
FT                   /protein_id="CAQ31325.1"
FT                   /translation="MFERNREATMIFNIQRYSTHDGPGIRTVVFLKGCSLGCRWCQNPE
FT                   SRARTQDLLYDARLCLEGCELCAKAAPEVIERALNGLLIHREKLTPEHLTALTDCCPTQ
FT                   ALTVCGEVKSVEEIMATVLRDKPFYDRSGGGLTLSGGEPFMQPEMATALLQASHEAGIH
FT                   TAVETCLHVPWKYIAPSLPYIDLFLADLKHVADAPFKQWTDGNAARVLDNLKKLAAAGK
FT                   KIIIRVPLIQGFNADETSVKAITDFAADELHVGEIHFLPYHTLGINKYHLLNLPYDAPE
FT                   KPLDAPELLDFAQQYACQKGLTATLRG"
     atgtttgaac gaaacagaga ggcaactatg attttcaata ttcagcgcta ctcgacccat        60
     gatggccccg gtatccgcac ggtcgtattt cttaaaggct gttcgctggg ctgccgctgg       120
     tgtcagaacc cggaaagccg cgcccgcacg caggatctgc tgtatgacgc acgactgtgt       180
     ctggaaggct gcgagctgtg cgctaaggcc gcgccggaag tgattgagcg cgcgctgaat       240
     ggtttgctta ttcatcggga aaagttaacc ccggagcatc tgacggcgtt aaccgactgc       300
     tgtccgacac aggcgttaac cgtgtgtggt gaagtgaaaa gcgttgagga gatcatggcg       360
     accgttttgc gcgataaacc gttttacgat cgcagcggcg gcggcttaac gctttcgggt       420
     ggtgaaccct ttatgcagcc ggagatggcg acggcgctac tgcaagccag ccacgaggca       480
     ggcattcata ctgcagtaga aacctgtctg catgtgccgt ggaaatatat cgccccttct       540
     ctgccctata tcgatctgtt tcttgccgat ttaaaacacg ttgccgacgc gccgtttaaa       600
     cagtggaccg acggtaacgc cgccagagtg ctggataacc tgaaaaaact cgccgcagcg       660
     ggcaaaaaaa tcattatccg cgtgccgctg attcagggct ttaatgccga cgaaacctct       720
     gtaaaagcca ttaccgattt tgccgccgac gagctgcacg ttggcgaaat tcatttcctg       780
     ccctaccaca cgctgggcat caacaaatat cacttactta atctgcccta tgacgccccg       840
     gaaaaaccgc ttgatgcgcc agaactgctc gattttgccc agcagtatgc ctgccagaaa       900
     gggttaaccg cgaccttacg aggataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page