(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJH

AM946981.YBJH        Location/Qualifiers
FT   CDS_pept        complement(868859..869143)
FT                   /transl_table=11
FT                   /gene="ybjH"
FT                   /locus_tag="B21_00827"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00827"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31344"
FT                   /protein_id="CAQ31344.1"
FT                   /translation="MIMKNCLLLGALLMGFTGVAMAQSVTVDVPSGYKVVVVPDSVSVP
FT                   QAVSVATVPQTVYVAPAPAPAYRPHPYVRHLASVGEGMVIEHQIDDHHH"
     atgattatga aaaattgtct actgttgggc gcgcttttaa tgggctttac tggtgtggcg        60
     atggcgcaaa gtgtcaccgt cgatgtgccg agtggataca aagtggttgt ggttcctgat       120
     tcagtcagcg ttccacaagc ggtcagcgtc gcgactgtgc cgcaaaccgt ctatgtggct       180
     cctgcgccag ctccggctta ccgcccgcat ccttatgttc gccatcttgc cagcgtaggt       240
     gaagggatgg ttatcgaaca ccagattgac gaccatcacc attaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page