(data stored in SCRATCH zone)

EMBL: AM946981.YBJM

AM946981.YBJM        Location/Qualifiers
FT   CDS_pept        894787..895164
FT                   /transl_table=11
FT                   /gene="ybjM"
FT                   /locus_tag="B21_00859"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00859"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31376"
FT                   /protein_id="CAQ31376.1"
FT                   /translation="MKHKQRWAGAICCFVLFIVVCLFLATHMKGAFRAAGHPEIGLLFF
FT                   ILPGAVASFFSQRREVLKPLFGAMLAAPCSMLIMRLFFSPTRSFWQELAWLLSAVFWCA
FT                   LGALCFLFISSLFKPQHRKNQ"
     gtgaaacata aacaacgttg ggcgggggca atctgctgtt ttgtcctctt cattgtggtg        60
     tgcctttttc tggcgacgca catgaaaggc gcttttcggg ctgccgggca tcctgaaatc       120
     ggcttgctat ttttcattct tcctggagca gtcgccagct tcttttcaca gcgtagagaa       180
     gtcctgaaac ctctgtttgg cgcaatgctg gcggcaccct gttcgatgct cattatgcgg       240
     ctgttttttt caccgacgcg ctcattctgg caagagctgg catggttact aagcgcggtg       300
     ttctggtgtg cgctgggggc actgtgtttc ttatttatca gtagtttgtt taaaccacag       360
     cacagaaaaa atcagtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page