(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJO

AM946981.YBJO        Location/Qualifiers
FT   CDS_pept        902687..903175
FT                   /transl_table=11
FT                   /gene="ybjO"
FT                   /locus_tag="B21_00869"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00869"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31386"
FT                   /protein_id="CAQ31386.2"
FT                   /translation="MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFN
FT                   TLGVRGIGEFIHRSVQTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITA
FT                   ASYLWAASLGYGYPELFSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ"
     atggaagacg aaacgttggg attttttaag aaaacatctt catctcatgc tcgcctgaat        60
     gtgcctgcgc tggtgcaggt agcggcgctc gccattatta tgatccgtgg cctcgacgtg       120
     ctgatgattt tcaatacgct gggcgtgcgc ggtattggcg agttcattca tcgcagcgta       180
     caaacctgga gcttaacgct ggtcttttta agcagtctgg tgctggtttt tatcgagatc       240
     tggtgtgcgt tttcactggt gaaagggcgt cgctgggcgc gctggctata tctgctgaca       300
     caaatcaccg ccgcaagtta cttgtgggcg gcttcgctgg ggtatggtta tccggagctg       360
     ttcagcattc ccggtgaatc aaaacgtgaa atcttccata gcctgatgct gcagaagctg       420
     ccggatatgc tcatcctgat gctgctgttc gttccctcga ccagtcggcg gttcttccag       480
     ttgcaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page