(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJS

AM946981.YBJS        Location/Qualifiers
FT   CDS_pept        complement(910438..911451)
FT                   /transl_table=11
FT                   /gene="ybjS"
FT                   /locus_tag="B21_00879"
FT                   /product="predicted NAD(P)H-binding oxidoreductase with
FT                   NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00879"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31396"
FT                   /protein_id="CAQ31396.1"
FT                   /translation="MKVLVTGATSGLGRNAVEFLCQKGISVRATGRNEAMGKLLEKMGA
FT                   EFVPADLTELVSSQAKVMLAGIDTLWHCSSFTSPWGTQQAFDLANVRATRRLGEWAVAW
FT                   GVRNFIHISSPSLYFDYHHHRDIKEDFRPHRFANEFARSKAASEEVINMLSQANPQTRF
FT                   TILRPQSLFGPHDKVFIPRLAHMMHHYGSILLPHGGSALVDMTYYENAVHAMWLASQEA
FT                   CDKLPSGRVYNITNGEHRTLRSIVQKLIDELNIDCRIRSVPYPMLDMIARSMERLGRKS
FT                   AKEPPLTHYGVSKLNFDFTLDITRAQEELGYQPVITLDEGIEKTAAWLRDHGKLPR"
     atgaaggtac tggttaccgg cgccaccagc ggcttaggtc gaaacgcggt agagttttta        60
     tgccagaaag gcatcagcgt gcgagcgacc ggtcgcaacg aggcaatggg caaattgctg       120
     gaaaaaatgg gcgcagagtt tgttccggcg gatctgaccg agctggtttc atcacaagct       180
     aaagtgatgc tcgcgggcat tgatacgctg tggcactgct ccagctttac ctcaccctgg       240
     gggacacaac aggctttcga tctggctaac gttcgcgcca ctcgccgcct gggtgaatgg       300
     gctgtcgcct ggggtgtgcg taactttatt catatctctt ccccctccct gtacttcgat       360
     tatcaccacc atcgcgatat taaagaagat tttcgccctc accgcttcgc caacgagttt       420
     gcccgcagca aagcagccag cgaagaagtg atcaatatgc tttcgcaggc gaatccacaa       480
     acgcgcttta ctattctgcg cccacaaagt ctgttcggac cgcacgataa agtctttatt       540
     ccccgtctgg cgcatatgat gcaccactac ggcagtattc tgttaccgca tggcggcagt       600
     gcgctggtcg atatgaccta ctatgaaaat gccgtgcacg caatgtggct ggcaagccag       660
     gaagcctgcg ataagctacc ttccgggcgt gtgtacaaca tcaccaacgg cgagcatcgc       720
     acactgcgca gcatcgtgca gaagctgatc gacgagttga atattgactg tcgtattcgt       780
     tccgtcccct acccgatgct ggatatgatc gcccgcagca tggagcgttt aggccgcaag       840
     tcagcaaaag agccgccgct gacccactac ggcgtctcca agttgaattt tgactttacg       900
     ctggatatta cgcgtgcgca ggaagagtta ggttatcagc cggtcatcac cctggatgaa       960
     ggtatcgaga aaactgccgc ctggctacgc gaccacggaa aactgccgcg ctaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page