(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJT

AM946981.YBJT        Location/Qualifiers
FT   CDS_pept        complement(911550..912980)
FT                   /transl_table=11
FT                   /gene="ybjT"
FT                   /locus_tag="B21_00880"
FT                   /product="conserved protein with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31397"
FT                   /protein_id="CAQ31397.1"
FT                   /translation="MPQRILVLGASGYIGQHLVRTLSRQGHQILAAARHVDRLAKLQLA
FT                   NVSCHKVDLSWPDNLPALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVK
FT                   QLIFLSSLQAPPHEQSDHLRARQATADILREANVPVTELRAGIIVGAGSAAFEVMRDMV
FT                   YNLPVLTPPRWVRSRTTPIALENLLHYLVALLDHPASEHRIFEAAGPEVLSYQQQFEHF
FT                   MAVSGKRRWLIPIPLPTRWISVWFLNVITSVPPTTARALIQGLKHDLLADDTALRALIP
FT                   QRLIAFDDAVRSTLKEEEKLVNSSDWGYDAQAFARWRPEYGYFAKQAGFTVKTSASLAA
FT                   LWQVVNQIGGKERYFFGNILWQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVV
FT                   EPEKQLTLLFGMKAPGLGRLCFSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLF
FT                   IFRGMAKQIARLAEQSTD"
     gtgccgcaac gcattttagt tctcggtgcc agtggctaca ttggtcagca tctggtgcgc        60
     acactcagcc ggcaagggca tcagatcctg gcggcggcac gtcatgtcga caggcttgca       120
     aagctgcaac tggcaaacgt cagttgccat aaagtcgatc tcagctggcc ggataacctt       180
     ccggccctgt tgcaggatat cgataccgtc tattttctgg tgcacagcat gggcgaaggc       240
     ggcgatttta tcgctcagga gcgccaggtg gctctcaacg tccgcgatgc gctacgtgaa       300
     gtaccagtta agcaattaat ctttctcagt tcgttgcagg ccccgccaca tgagcagtcg       360
     gatcatctgc gtgctcgtca ggctacggcg gacattcttc gtgaagcgaa tgtacctgtg       420
     accgaacttc gggccggaat tatcgttggc gcaggttcag cggcgttcga agtcatgcgc       480
     gatatggtct acaacctgcc agtgttaacg ccgccacgct gggtacgttc acgcaccacg       540
     cccatcgcgc tggaaaactt gctgcactat ctggtggcgt tgttagatca tccggccagc       600
     gaacaccgca tcttcgaagc cgccggacca gaggtgctca gttatcagca acagtttgaa       660
     cattttatgg cggtgagcgg taagcgccgc tggttgatcc ccatccccct ccccacccgc       720
     tggatttcgg tgtggtttct caatgtgatt acttccgtac cgcccaccac cgccagggcg       780
     ttgattcagg ggctgaaaca cgatctgctg gcggatgata ccgcgctacg tgcactcatc       840
     ccacaacggc tgatcgcttt cgatgacgcg gtacgtagca cgttgaaaga ggaggaaaaa       900
     ctggtcaact ccagcgactg gggctacgac gctcaggcct ttgcccgctg gcgaccggag       960
     tacggttatt ttgccaaaca ggcggggttt accgttaaaa cgtccgccag ccttgctgct      1020
     ttatggcagg tagtgaacca aatcggcggt aaagagcgtt atttctttgg caatattttg      1080
     tggcagacac gggcgttgat ggaccgcgcg atcggtcata agctggcgaa aggccgcccg      1140
     gagcgcgaat atttacagac tggcgatgcg gtggatagct ggaaagtgat tgtcgttgaa      1200
     ccggaaaaac aacttacgtt gttatttggc atgaaagcgc cggggctggg acgactgtgt      1260
     tttagcctgg aagataaagg cgactatcgt actatcgatg tccgcgcttt ctggcatccg      1320
     cacggtatgc cggggctgtt ttactggtta ttgatgatcc ccgcgcatct gtttattttt      1380
     cgcggaatgg caaaacaaat cgccagactg gcagaacaaa gcacagatta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page