(data stored in SCRATCH zone)

EMBL: AM946981.YBL15

AM946981.YBL15       Location/Qualifiers
FT   CDS_pept        complement(535264..535542)
FT                   /transl_table=11
FT                   /gene="ybl15"
FT                   /locus_tag="B21_00493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31010"
FT                   /protein_id="CAQ31010.2"
FT                   /translation="MFRIILPNTWYVDHHGTPCKILRSTHNKVHYIRKGRTCIASMFRF
FT                   NHDFEPVNKADADRIAEEIETAEHIKKLRDMRSKSRGNHGIIQPHTR"
     atgttcagaa tcattttgcc taacacctgg tacgtcgacc accacggcac tccctgcaaa        60
     atcctgcgtt ctacccacaa caaagttcac tacatccgaa aaggcagaac atgtatcgcc       120
     agcatgttcc gctttaatca tgactttgaa cctgtgaata aagctgatgc agatcggata       180
     gcagaagaga tcgaaacggc agaacacatt aagaagttac gtgacatgcg ttcaaaaagc       240
     agaggtaacc atggaatcat acagcctcac actcgatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page