(data stored in ACNUC7421 zone)

EMBL: AM946981.YBL36

AM946981.YBL36       Location/Qualifiers
FT   CDS_pept        complement(879949..880974)
FT                   /transl_table=11
FT                   /gene="ybl36"
FT                   /locus_tag="B21_00840"
FT                   /product="capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31357"
FT                   /protein_id="CAQ31357.2"
FT                   /translation="MGKSKKNRAAATNQIQHKNQTSAEAFSFGDPVPVLDRRELLDYVE
FT                   CVKMDRWYEPPVSFDGLARTFRAAVHHSSPIAVKCNILTSTYIPHPLLSQQAFSRFVQD
FT                   YLVFGNAYLEKRTNRFGEVIALEPALAKYTRRGLDLDTYWFVQYGMTTQPYQFTKGSIF
FT                   HLMEPDINQEIYGLPGYLSAIPSALLNESATLFRRKYYINGSHAGFIMYMTDAAQNQED
FT                   VNNLRNAMKSAKGPGNFRNLFMYSPNGKKDGLQIIPLSEVTAKDEFLNIKNVSRDDMMA
FT                   AHRVPPQMMGIMPNNVGGFGDVEKASKVFVRNELMPLQKRLQELNNWLDEEVLNFSTYE
FT                   L"
     atgggaaaga gtaagaaaaa ccgcgctgcg gcgacgaacc agatccagca taaaaaccaa        60
     acttcagccg aagcattcag cttcggtgat cccgttcctg ttctggaccg ccgcgaatta       120
     ctggactatg tggaatgcgt aaagatggac cgctggtatg agccacccgt aagttttgac       180
     ggactggcgc gaacattccg cgccgccgta caccacagtt caccgattgc agtaaagtgc       240
     aacattctga ccagcaccta catccctcac ccgctgctca gccagcaggc gttttcacgt       300
     tttgtgcagg actatctggt ttttggtaac gcctacctgg agaaacgcac gaaccgattc       360
     ggtgaagtta tcgcccttga gcctgcgctg gcaaaataca cccgacgcgg attagaccta       420
     gatacctact ggtttgtgca atacggcatg accacgcagc cgtatcagtt cacgaaaggc       480
     agcatttttc atctgatgga accggacatc aaccaggaga tctacggcct gcccggctat       540
     ctttctgcca tcccatccgc cctgctcaac gagtccgcca cgctgttccg ccgaaagtat       600
     tacattaacg gtagtcatgc aggcttcatc atgtacatga ccgatgccgc gcagaaccag       660
     gaagatgtga acaacctccg caatgcgatg aaaagtgcca aaggccctgg caacttccgc       720
     aacctgttta tgtactcgcc taatggtaaa aaagacggac ttcagattat cccgttgtca       780
     gaagtcacag cgaaggatga gtttctgaat atcaagaacg tgagccgtga tgacatgatg       840
     gcggcacacc gcgtgccgcc gcaaatgatg ggaattatgc ctaataatgt cggggggttt       900
     ggggatgtgg agaaggctag caaggtattc gtaagaaacg aattgatgcc cctgcagaaa       960
     cgattgcagg aactaaataa ctggttggac gaagaagtgc tcaatttttc aacctatgag      1020
     ctttag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page