(data stored in SCRATCH zone)

EMBL: AM946981.YKGO

AM946981.YKGO        Location/Qualifiers
FT   CDS_pept        complement(282551..282691)
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="B21_00258"
FT                   /product="predicted ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30775"
FT                   /protein_id="CAQ30775.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
     atgaaagttc ttaactctct gcgtaccgca aaagaacgcc atccagactg tcagattgtg        60
     aagcgaaaag gacggctata tgtgatttgt aaatctaatc cacgttttaa ggccgttcag       120
     ggtcgtaaga aaaaacgttg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page