(data stored in ACNUC7421 zone)

EMBL: AM946981.YKGR

AM946981.YKGR        Location/Qualifiers
FT   CDS_pept        complement(283318..283419)
FT                   /transl_table=11
FT                   /gene="ykgR"
FT                   /locus_tag="B21_04538"
FT                   /product="small predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_04538"
FT                   /db_xref="EnsemblGenomes-Tr:CBY77800"
FT                   /protein_id="CBY77800.1"
FT                   /translation="MKENKVQQISHKLINIVVFVAIVEYAYLFLHFY"
     atgaaagaga ataaagtaca gcaaatcagt cataaactga ttaatatcgt tgtttttgtc        60
     gcaattgtag aatacgccta tttatttctc catttctatt aa                          102
//

If you have problems or comments...

PBIL Back to PBIL home page