(data stored in ACNUC7421 zone)

EMBL: AM946981.YLIL

AM946981.YLIL        Location/Qualifiers
FT   CDS_pept        836657..836926
FT                   /transl_table=11
FT                   /gene="yliL"
FT                   /locus_tag="B21_00800"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31317"
FT                   /protein_id="CAQ31317.1"
FT                   /translation="MERGPHPRAAIYAGLQEDRASRRSGQLLTNKSFAKGIANPTKSGV
FT                   FQTKTRYACMKAGVKRRTATPLFIGRFILLRFVVDHIAQHREQH"
     gtggaaaggg gtccgcatcc gcgagccgca atatacgcag ggctgcaaga agatagagcg        60
     agccgccgtt caggtcaact actgacgaac aaatcttttg cgaaggggat tgcaaatccg       120
     acaaaaagtg gggtttttca gaccaaaacg cgttatgcct gcatgaaagc aggagtgaag       180
     cggcgtaccg cgacgccgct atttatcgga aggtttatct tgctgcggtt tgttgttgac       240
     catatcgcac aacatagaga gcagcattaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page