(data stored in ACNUC8465 zone)

HOGENOMDNA: ANADE_1

ID   ANADE_1; SV 1; empty ; DNA; empty ; PRO; 5013479 BP.
XX
AC   NC_007760;
XX
PR   Project: 58135;
XX
DE   Anaeromyxobacter dehalogenans 2CP-C, complete genome.
XX
OS   Anaeromyxobacter dehalogenans 2CP-C
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Myxococcaceae; Anaeromyxobacter.
XX
RN   [1]
RP   1-5013479
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T.,
RA   Hammon,N., Israni,S., Pitluck,S., Brettin,T., Bruce,D., Han,C., Tapia,R.,
RA   Gilna,P., Kiss,H., Schmutz,J., Larimer,F., Land,M., Kyrpides,N.,
RA   Anderson,I., Sanford,R.A., Ritalahti,K.M., Thomas,H.S., Kirby,J.R.,
RA   Zhulin,I.B., Loeffler,F.E. and Richardson,P.;
RT   "Complete sequence of Anaeromyxobacter dehalogenans 2CP-C";
RL   Unpublished
XX
RN   [2]
RP   1-5013479
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (09-MAY-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-5013479
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T.,
RA   Hammon,N., Israni,S., Pitluck,S., Brettin,T., Bruce,D., Han,C., Tapia,R.,
RA   Gilna,P., Kiss,H., Schmutz,J., Larimer,F., Land,M., Kyrpides,N.,
RA   Anderson,I., Sanford,R.A., Ritalahti,K.M., Thomas,H.S., Kirby,J.R.,
RA   Zhulin,I.B., Loeffler,F.E. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (24-JAN-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000251.
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Frank Loeffler
CC   (frank.loeffler@ce.gatech.edu)
CC   Contact: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..5013479
FT                   /strain="2CP-C"
FT                   /mol_type="genomic DNA"
FT                   /organism="Anaeromyxobacter dehalogenans 2CP-C"
FT                   /db_xref="taxon:290397"
FT   gene            22..1395
FT                   /db_xref="GeneID:3890401"
FT                   /locus_tag="Adeh_0001"
FT   CDS_pept        22..1395
FT                   /locus_tag="Adeh_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /db_xref="GI:86156431"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:3890401"
FT                   /translation="MEAPASALVETPLDDLWSRIDGFLRARCREDLYERWFEPLRPVSL
FT                   GEGRLQIGAPDKFHRDFVEDNYRGWFEEFIPELTGERLRIAFAVDDAPRPIGAPASPPP
FT                   AAVAARAAEPHLEPRDSRPNPRYAFDTFVVGASNHFAFAAAQAVAANPGRTWNPLFLHG
FT                   DSGLGKTHLLHAVAHAILEKSGGRVAIVSSERYTNDFVAALSRGTMDEFRRKYRECSAL
FT                   LVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDERLCSRFEWGMR
FT                   VQIEVPEFETRAAILQKKADVEKIDLPDDVTQLLAQHIRSNVRELEGALMRLAAFASLK
FT                   SEPITVPLARDVLSDVIPPPGYRPPIEKIQEAVAGHYGLTVAKLTSASREQKIAFPRQV
FT                   AMYLCRELAKEKFQSIAEKFNKKDHTTVIAAVDRVKGLLESDDAVRTAVAQLSAKLAP"
FT                   /protein_id="YP_463216.1"
FT   misc_feature    58..1386
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    475..858
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    508..531
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    order(511..534,694..696,793..795)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    685..699
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    832..834
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    1117..1386
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Adeh_0001"
FT   misc_feature    order(1186..1188,1210..1215,1234..1236,1252..1260,
FT                   1285..1299,1306..1308,1315..1320)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Adeh_0001"
FT   gene            1811..2938
FT                   /db_xref="GeneID:3890402"
FT                   /locus_tag="Adeh_0002"
FT   CDS_pept        1811..2938
FT                   /product="DNA polymerase III, beta subunit"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Adeh_0002"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GI:86156432"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:3890402"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFADVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERTVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRARFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
FT                   /transl_table="11"
FT                   /protein_id="YP_463217.1"
FT   misc_feature    1811..2935
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Adeh_0002"
FT   misc_feature    1811..2932
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Adeh_0002"
FT   misc_feature    order(1880..1882,2027..2029,2048..2050,2405..2407)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Adeh_0002"
FT   misc_feature    order(2030..2032,2039..2041,2117..2119,2123..2125,
FT                   2645..2647,2738..2743)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Adeh_0002"
FT   misc_feature    order(2324..2326,2330..2341,2789..2791,2921..2932)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Adeh_0002"
FT   misc_feature    order(2324..2326,2330..2335,2570..2572,2675..2677,
FT                   2714..2719,2798..2800,2921..2932)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Adeh_0002"
FT   gene            2958..4076
FT                   /db_xref="GeneID:3890403"
FT                   /locus_tag="Adeh_0003"
FT   CDS_pept        2958..4076
FT                   /locus_tag="Adeh_0003"
FT                   /gene_family="HOG000269561" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /db_xref="GI:86156433"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:3890403"
FT                   /translation="MKLLSLHVQDFRNLAAVELAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGAADAAVAGDFEGPGGVRRVAVQVAAGGRTASLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRSGTAEVEASFREPLVRAGARLLVRRRDLVAELAPRLRAAFAEISGPAAPEADLA
FT                   YRAAGGVEVGHPEAEVAARLARALETRLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTTTDRRLIEPAAGPDTAFYEVRSGVVSPLVS"
FT                   /protein_id="YP_463218.1"
FT   misc_feature    2964..>3425
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3045..3068
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    order(3054..3059,3063..3071,3318..3320)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3309..3320
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    <3741..4061
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3798..3827
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3885..3902
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3909..3920
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   misc_feature    3978..3998
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Adeh_0003"
FT   gene            4264..6651
FT                   /db_xref="GeneID:3890404"
FT                   /locus_tag="Adeh_0004"
FT   CDS_pept        4264..6651
FT                   /product="DNA gyrase subunit B"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Adeh_0004"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="GI:86156434"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR011558"
FT                   /db_xref="GeneID:3890404"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGARGLHHLVYEVVDNSVDEAMAGRAN
FT                   EINVAIHADNSVTVLDNGSGIPVGPHPTVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYRDGKVWAQRYERGTPAGKVTAIGETQRRGTRITFKPDAT
FT                   IFEVTEYSFETLSGRLRELAFLNAGLKITIEDERHGKKHEFLFKDGIREFVAFLNKSRD
FT                   VLFQPPIALRQEVETERGAALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISVRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLSAFLDENPNVAKRICGKVAEAARARIAARKARETVRRKGALDSASLPGK
FT                   LADCQSRDPKESELYLVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLGSA
FT                   EIATIITALGTGIGPEEFDVEKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPSVIER
FT                   GLVYIAQPPLFRVAKGKKESYLKDEAALDEYLLALGTDRTRLVAGETVVEGRDLARLAR
FT                   DAIAYRALLARVDRRRDSRIVDAAIQLGDLDLDLLKHHEQVKEQVQKIFEKAQKLHPEL
FT                   QVRIAKIERDEEHGCDALVYQTSMAGAPRDTRLDHDYLSGAEWGELAALHAAIAELGPG
FT                   PFRLETPEGAEEVLDVFEAVEAVKKAAGQGQTIQRYKGLGEMNPEQLWETTMDPARRTM
FT                   LQVRVDDTVEADEVFSILMGDAVEPRREFIEKHALDVQNLDI"
FT                   /transl_table="11"
FT                   /protein_id="YP_463219.1"
FT   misc_feature    4324..4752
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    4885..5367
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    5050..5052
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    order(5227..5229,5236..5241,5245..5247)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    order(5245..5247,5251..5253)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    5494..5838
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    order(5512..5517,5524..5526,5734..5736,5740..5742,
FT                   5746..5748)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    order(5512..5514,5734..5736)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Adeh_0004"
FT   misc_feature    6427..6615
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Adeh_0004"
FT   gene            6733..7728
FT                   /db_xref="GeneID:3890405"
FT                   /locus_tag="Adeh_0005"
FT   CDS_pept        6733..7728
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Adeh_0005"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="GI:86156435"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="GeneID:3890405"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTRHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGMYRRILLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSCHLHADGRFARDLFTDAPGSIYHPRVQPRMLEDASIFPHME
FT                   GQKVFKHAVVRMPEVLKEAFDKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVVRGDLVGLCAFGAGFTWASALVRW"
FT                   /transl_table="11"
FT                   /protein_id="YP_463220.1"
FT   misc_feature    6733..7725
FT                   /note="3-oxoacyl-(acyl carrier protein) synthase III;
FT                   Reviewed; Region: PRK09352"
FT                   /db_xref="CDD:169809"
FT                   /locus_tag="Adeh_0005"
FT   misc_feature    6739..7719
FT                   /note="Ketoacyl-acyl carrier protein synthase III (KASIII)
FT                   initiates the elongation in type II fatty acid synthase
FT                   systems. It is found in bacteria and plants. Elongation of
FT                   fatty acids in the type II systems occurs by Claisen
FT                   condensation of malonyl-acyl...; Region: KAS_III; cd00830"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Adeh_0005"
FT   misc_feature    order(6976..6978,6982..6984,7009..7011,7018..7020,
FT                   7042..7062,7084..7086,7093..7098,7105..7110,7165..7167,
FT                   7282..7299,7315..7320,7693..7695)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Adeh_0005"
FT   misc_feature    order(7069..7071,7504..7506,7594..7596)
FT                   /note="active site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Adeh_0005"
FT   misc_feature    7513..7515
FT                   /note="CoA binding pocket; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Adeh_0005"
FT   gene            7820..7893
FT                   /db_xref="GeneID:3890406"
FT                   /locus_tag="Adeh_R0001"