(data stored in ACNUC1104 zone)

EMBL: AP008957.ACOA/ACOB

AP008957.ACOA/ACOB   Location/Qualifiers
FT   CDS_pept        492151..494133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoA/acoB"
FT                   /locus_tag="RER_04420"
FT                   /product="putative acetoin dehydrogenase E1 component"
FT                   /EC_number="1.1.1.-"
FT                   /note="protein synonym:acetoin--2,6-
FT                   dichlorophenolindophenol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31150"
FT                   /db_xref="GOA:C0ZN98"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN98"
FT                   /protein_id="BAH31150.1"
FT                   /translation="MFRLVNGEEVLCAYEKMLLIRVMEERISALYKGDIIPGFVHTSIG
FT                   QEACAVGALTHARVSDVITSTHRGHGHVLAKGLEPDRMMAELMGKVTGANNGRGGSMHV
FT                   ADPRLGIFGANGIVGAGLPIAVGAAFAAKDRGEGDLVVAFFGDGAIATGAFHEAMNLAA
FT                   LWKLPIIFLCENNGFSEFSSTVDQHPVPISARAAGYGMESITLAGNDVEAVADGIRPVY
FT                   AQVRGGSGPVFVEVTTLRVHGHYEGDPQVYRDKDEMTRDILAADPLTVTRGRLRERGIG
FT                   DDVLDLVDKRVRAVVDEAERFARASPQPEASSVMEYIYSPRRVYPPGHLDVSVDAGGAA
FT                   VSQSKIIKAALDDSLAADPDVFLAGIDVAGGNVFGLTRGLAAEYPGRVLDTPISESAIM
FT                   GLAVGSAMAGRRPVVELMYLDFLGVCLDQLMNQAAKLRFMTGGAVSLPLVVRTQFGSGR
FT                   SSGGQHSQSLEALLAHIPGLTVLMPSSGADAYGLLRAAIEDDNPVMFIEHRLLYEKKSS
FT                   LPSKDFRVPIGKAAVTRPGSDVTIVSWSRMAMHALVAAQTLTEEGIDAEVIDLRTIAPL
FT                   DRETILESFGRTNRMVVAQEAVVDFGVGAEIAAMAVDSGFYSLDAPVVRVGARYAPAPY
FT                   APVLEREWEVGPDDIVAAVRRVMSC"
     gtgttccggc tcgtgaacgg cgaagaagtt ctgtgtgcct acgaaaagat gttgttgatc        60
     cgtgtgatgg aggagcgcat ctcggcgctc tacaagggcg acatcattcc cggattcgtt       120
     cacacctcga taggtcaaga ggcatgcgcg gtgggggctc tcactcatgc gcgggtcagt       180
     gacgtcatca cctcgacgca ccgcgggcac ggccacgttc tcgccaaagg cctcgagccc       240
     gatcggatga tggccgagtt gatgggcaag gttaccgggg ccaacaacgg ccggggtggt       300
     tcgatgcacg tcgccgatcc ccgcctgggg atcttcggcg cgaacgggat cgtgggcgcg       360
     gggttgccga tcgccgtcgg tgctgccttc gctgccaagg atcgcggtga gggcgatctg       420
     gtggtggcgt tcttcggtga cggggcgatc gcgaccggcg cgttccacga ggcgatgaac       480
     ttggctgcgc tgtggaaact tccgatcatt ttcctgtgcg agaacaacgg attctcggag       540
     ttctcctcga cggtggatca gcatccggtt ccgatctctg cgcgcgcagc gggatacgga       600
     atggaatcga tcacgctggc aggcaacgac gtcgaggcag tcgccgacgg tattcggccg       660
     gtgtacgcgc aggtgcgagg cggcagtggt ccggtgttcg tcgaggtcac gaccctgcgg       720
     gtgcacgggc actacgaggg cgatccgcag gtgtaccgcg acaaggacga gatgacccga       780
     gacattctcg cggccgatcc actgacggtg acgcggggcc gactccggga gcgaggcatc       840
     ggggacgatg tcctcgatct ggtggacaag cgggtgaggg cggtggtcga cgaggcggag       900
     cgtttcgcgc gggcgtcgcc gcaaccggag gcgtcgagcg tgatggagta catctattca       960
     ccgcgacgtg tctatccgcc gggccacctc gacgtgagtg tcgacgcggg tggtgcggcg      1020
     gtgtcccagt ccaagatcat caaagcggcg ctcgacgact ctctggcagc cgatccggat      1080
     gtgtttcttg ctggcatcga cgttgccggc ggaaatgttt tcggtctgac caggggattg      1140
     gccgcggagt atccgggtcg agtgctcgat acgccgatct ccgaatcggc aatcatgggt      1200
     cttgccgtcg gctccgcgat ggcgggccgt aggcccgtcg tggaactgat gtacctcgac      1260
     ttcctcgggg tgtgcctgga tcagttgatg aatcaggcgg caaaacttcg gttcatgacg      1320
     ggcggcgcag tgagtctgcc gttggtggtg cggacgcagt tcggttccgg cagatcgtcg      1380
     ggtgggcagc attcgcagag tctcgaggcg ctgttggcgc acataccggg actgactgtg      1440
     ctcatgccga gttcgggcgc ggatgcatac gggttgttgc gggcagcgat cgaggacgac      1500
     aacccggtca tgttcatcga gcatcgactg ctgtacgaga agaaaagttc gttgccgagc      1560
     aaggattttc gggttccgat cggaaaggca gcggtgacga gaccaggttc ggacgtcacc      1620
     atcgtctcgt ggtcgcgtat ggcaatgcac gctttggttg cggcgcagac gttgacagag      1680
     gaagggatcg atgcggaggt catcgatcta cgaacgattg ctccgctcga tcgggagacg      1740
     attctcgaat ccttcggtcg gaccaacagg atggtcgtcg cccaggaagc ggtggtggac      1800
     ttcggtgtcg gagccgagat cgcagccatg gcggtggatt ccggtttcta ttctctggac      1860
     gcgccggtgg tgcgggtggg agcacggtac gcgcccgcgc cctatgcgcc ggtgctcgaa      1920
     cgtgagtggg aagtcggacc tgacgacatc gttgcagccg ttcggcgggt gatgtcgtgc      1980
     tga                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page