(data stored in ACNUC1104 zone)

EMBL: AP008957.AMIS

AP008957.AMIS        Location/Qualifiers
FT   CDS_pept        complement(544982..545602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiS"
FT                   /locus_tag="RER_04930"
FT                   /product="putative amidase substrates transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31201"
FT                   /db_xref="GOA:C0ZNE9"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE9"
FT                   /protein_id="BAH31201.1"
FT                   /translation="MGSVGLLYVGAVLFVNGLMLLGTVPVRSASVLNLFVGALQCVVPT
FT                   VLLIQAQGDSSAVLAASGLYLFGFTYLYVGISNLAGFEPEGIGWFSLFVACAALVYSFL
FT                   SFTVSNDPVFGVIWLAWAALWTLFFLVLGLGRENLSRFTGWAAVLLSQPTCTVPAFLIL
FT                   TDNFHTTPAVAAGWAGALLVLLGLAKILAAPKAAVPQTHPVFN"
     atgggcagtg ttggtttgct ttacgtggga gccgtcctct tcgtcaacgg actgatgctg        60
     ctcggcacag ttcccgttcg atccgcctcg gtcctcaacc tcttcgtcgg cgcacttcaa       120
     tgcgtcgtcc ccaccgtttt gttgattcag gcacagggag attcgagcgc cgtcctggcg       180
     gcctcaggtc tctacctgtt cggattcacc tacctctacg tgggaatcag caatctcgcc       240
     ggcttcgaac cggaaggaat cgggtggttc tcactgttcg tcgcgtgcgc cgcgctcgtg       300
     tactccttcc tctcgttcac ggtgagcaac gaccccgtct tcggggtcat ctggctcgca       360
     tgggcagcac tgtggacgct gttcttcctg gtgctcggcc tcggccgtga gaacctcagc       420
     cgcttcaccg gctgggcagc agtcctgctg agccagccca cctgtactgt tcccgccttt       480
     ctgatcctga ccgacaactt ccacaccaca cccgcggtag ccgccggctg ggccggagcg       540
     cttctggttc tcctcggcct ggccaagatc ctcgctgcac ccaaagccgc agttccccag       600
     actcatccag tcttcaactg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page