(data stored in ACNUC1104 zone)

EMBL: AP008957.ARGE

AP008957.ARGE        Location/Qualifiers
FT   CDS_pept        393020..394207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="RER_03540"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="protein synonym:N-acetylornithinase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31062"
FT                   /db_xref="GOA:C0ZM85"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM85"
FT                   /protein_id="BAH31062.1"
FT                   /translation="MSSTTLSAVPTERSLDWVQRLIGIDTTSAVSNRPLIDLIAAELRR
FT                   HGVEPILVSDDEGSKLNLLATFTPPDGSTAGGVMFSGHTDVVPVDDQDWSSHPFTPEIR
FT                   DGSLYGRGTCDMKSFIGIVVAAIPDIVARPLAKPIHFAFSYDEEVGCIGAAGLVEEVVS
FT                   RNLRPDVCVVGEPSEMRVIRAHKSMNVIRVDLHGVSAHSSLTPRGVNAIEYGAELIRFV
FT                   RSAADELRASGPYDDAFDVAWTTCSVNLVSGGIAVNTVPEDCSITFEFRSISSAGAADL
FT                   LERFAAEANRIENLMQEENPSASVTMHVSASVPPLETDANASAAALVEQWGGRPSDEKV
FT                   AYATEAGMFASIGVPTVVCGPGSITQAHAPDEYVTLDQLAQCEQFVRNVIAHARA"
     atgtcgtcca ccacgttgtc cgctgttcca accgagagaa gtctcgactg ggtgcagcgc        60
     ctcatcggaa tcgatacgac gagtgccgtg agcaatcgac cgttgatcga tctcatcgcc       120
     gcggaactac gtcgccacgg ggtcgagccg atactcgttt ccgacgacga gggttccaag       180
     ctgaacctgt tggcaacatt cacgcctcct gacggaagca ctgccggtgg agtgatgttt       240
     tccggccata cagatgtagt gccggtcgac gatcaagact ggagcagcca ccctttcact       300
     cccgaaattc gcgacggaag tctgtacgga cgcggcacgt gcgacatgaa gtcgttcatc       360
     gggatcgttg tcgcggcgat ccccgacatc gttgctcggc cgctggcgaa gccgattcac       420
     tttgcattct cctacgacga ggaagtcggc tgcatcggtg cggccgggtt ggtcgaggag       480
     gttgtttccc ggaacctgcg ccctgatgtg tgcgtcgtcg gagagccgtc ggagatgcgg       540
     gtcattcgcg cacacaagtc gatgaacgtc atacgtgttg atctgcatgg tgtttcggcg       600
     cactcgtcgc ttactccgcg aggagtcaac gcgatcgaat acggcgcgga gttgattcga       660
     ttcgtcagaa gcgcggccga cgagctccgt gcgtccggcc cgtacgacga cgcattcgac       720
     gtggcctgga cgacgtgttc ggtcaatctc gtatccggcg ggatcgcagt gaacactgtc       780
     cccgaggatt gctccatcac tttcgaattc aggagcatca gctcagctgg cgccgcagat       840
     ttgctcgaac gctttgccgc cgaagcgaat cggatcgaaa acctgatgca ggaagaaaac       900
     ccgtcagcct ccgtgacgat gcacgtgtcg gcctcggttc ctcccctgga gacggatgcg       960
     aatgcttcgg cggccgcact ggtcgaacaa tggggtggtc ggccctcgga cgaaaaggtc      1020
     gcgtacgcca ccgaggccgg gatgttcgcg agtatcggtg tccccactgt tgtgtgtggg      1080
     ccgggaagca tcactcaggc gcatgcacct gacgagtacg tgacacttga ccaattggca      1140
     cagtgcgagc agttcgttcg gaacgtcatc gctcacgccc gcgcctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page